From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan003129000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 3512336..3516304
  • synteny block?: BlockID0022210
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0855 (oppB)
    USA300_FPR3757:
    04-02981:
    SA2981_0940
    08BA02176:
    C248_1008
    11819-97:
    MS7_0940
    71193:
    ST398NM01_0981
    ECT-R 2:
    ECTR2_840
    ED133:
    SAOV_0931c
    ED98:
    SAAV_0946
    HO 5096 0412:
    SAEMRSA15_08140
    JH1:
    SaurJH1_1003
    JH9:
    SaurJH9_0984
    JKD6008:
    SAA6008_00938
    JKD6159:
    SAA6159_00842
    LGA251:
    M013:
    M013TW_0907
    MRSA252:
    SAR0948
    MSHR1132:
    SAMSHR1132_08330
    MSSA476:
    SAS0855
    Mu3:
    SAHV_0980
    Mu50:
    SAV0985
    MW2:
    MW0867
    RF122:
    SAB0851c
    ST398:
    SAPIG0981
    T0131:
    SAT0131_01018
    TCH60:
    HMPREF0772_12260
    TW20:
    USA300_TCH1516:
    USA300HOU_0943
    VC40:
    SAVC_04095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKKWLGMALITPILTFIIWLFNSHTIITYLNILFYVSLIIFISIFLILLVQEGIFDATS
    N315            MLKKWLGMALITPILTFIIWVFNSHTIITYLNILFYVSLIIFISIFLILLVQEGIFDATS
    NCTC8325        MLKKWLGMALITPILTFIIWLFNSHTIITYLNILFYVSLIIFISIFLILLVQEGIFDATS
    Newman          MLKKWLGMALITPILTFIIWLFNSHTIITYLNILFYVSLIIFISIFLILLVQEGIFDATS
                    ********************:***************************************

    COL             YGFRRLKYQMSSSKKKKSISDDPFFNPQEVKKEHYFVSTWIIPLLLINILYFIMTIVLSL
    N315            YGFRRLKYQMSSSKKKKSISDDPFFNPQEVKKEHYFVSTWIIPLLLINILYFIMTIVLSL
    NCTC8325        YGFRRLKYQMSSSKKKKSISDDPFFNPQEVKKEHYFVSTWIIPLLLINILYFIMTIVLSL
    Newman          YGFRRLKYQMSSSKKKKSISDDPFFNPQEVKKEHYFVSTWIIPLLLINILYFIMTIVLSL
                    ************************************************************

    COL             ILV
    N315            ILV
    NCTC8325        ILV
    Newman          ILV
                    ***