From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003134000
  • symbol?: opp-3C
  • description?: oligopeptide transport system permease OppC

      descriptions from strain specific annotations:

    • oligopeptide transport system permease OppC
    • binding-protein-dependent transport system inner membrane protein
    • peptide ABC transporter permease
    • Oligopeptide transport system permease protein oppC
    • oligopeptide ABC transporter permease
    • oligopeptide ABC superfamily ATP binding cassette transporter, permease protein
    • dipeptide transport system permease protein DppC
    • putative oligopeptide transport system permease
    • oligopeptide ABC transporter membrane protein
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • putative oligopeptide transport system permeaseprotein
    • binding--dependent transport system inner membrane component family protein
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein, Opp3C
  • strand?: +
  • coordinates?: 3517475..3518545
  • synteny block?: BlockID0022260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0992 (oppC)
    N315:
    NCTC8325:
    Newman:
    NWMN_0857 (oppC)
    USA300_FPR3757:
    04-02981:
    SA2981_0942 (oppC)
    08BA02176:
    C248_1010 (oppC)
    11819-97:
    MS7_0942
    71193:
    ST398NM01_0983
    ECT-R 2:
    ECTR2_842
    ED133:
    SAOV_0933
    ED98:
    SAAV_0948 (oppC)
    HO 5096 0412:
    SAEMRSA15_08160 (oppC)
    JH1:
    SaurJH1_1005
    JH9:
    SaurJH9_0986
    JKD6008:
    SAA6008_00940 (oppC)
    JKD6159:
    SAA6159_00844 (opp3C)
    LGA251:
    SARLGA251_09030 (oppC)
    M013:
    M013TW_0909
    MRSA252:
    SAR0950 (oppC)
    MSHR1132:
    SAMSHR1132_08350
    MSSA476:
    SAS0857
    Mu3:
    SAHV_0982
    Mu50:
    SAV0987
    MW2:
    MW0869
    RF122:
    SAB0853 (oppC)
    ST398:
    SAPIG0983
    T0131:
    SAT0131_01020
    TCH60:
    HMPREF0772_12258 (oppC)
    TW20:
    SATW20_09850 (oppC)
    USA300_TCH1516:
    USA300HOU_0945 (oppC1)
    VC40:
    SAVC_04105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAENKNNLSINDDHSNAAMTHTSDAIASSDFIIRELDLNQEPEMQRESKNFWQDAWAQLK
    N315            MAENKNNLSINDDHSNAAMTHTSDAIASSDFIIRELDLNQEPEMQRESKNFWQDAWAQLK
    NCTC8325        MAENKNNLSINDDHSNAAMTHTSDAIASSDFIIRELDLNQEPEMQRESKNFWQDAWAQLK
    Newman          MAENKNNLSINDDHSNAAMTHTSDAIASSDFIIRELDLNQEPEMQRESKNFWQDAWAQLK
    USA300_FPR3757  MAENKNNLSINDDHSNAAMTHTSDAIASSDFIIRELDLNQEPEMQRESKNFWQDAWAQLK
                    ************************************************************

    COL             RNKLAVVGMIGLIIIVIFAFIGPVINKHDYAEQNVEHRNLPAKIPVLDKVPFLPFDGKDA
    N315            RNKLAVVGMIGLIIIVIFAFIGPVINKHDYAEQNVEHRNLPAKIPVLDKVPFLPFDGKDA
    NCTC8325        RNKLAVVGMIGLIIIVIFAFIGPVINKHDYAEQNVEHRNLPAKIPVLDKVPFLPFDGKDA
    Newman          RNKLAVVGMIGLIIIVIFAFIGPVINKHDYAEQNVEHRNLPAKIPVLDKVPFLPFDGKDA
    USA300_FPR3757  RNKLAVVGMIGLIIIVIFAFIGPVINKHDYAEQNVEHRNLPAKIPVLDKVPFLPFDGKDA
                    ************************************************************

    COL             DGKDAYKAANAKENYWFGTDQLGRDLWTRTWKGAQISLFIGVVAAMLDIFIGVVYGAISG
    N315            DGKDAYKAANAKENYWFGTDQLGRDLWTRTWKGAQISLFIGVVAAMLDIFIGVVYGAISG
    NCTC8325        DGKDAYKAANAKENYWFGTDQLGRDLWTRTWKGAQISLFIGVVAAMLDIFIGVVYGAISG
    Newman          DGKDAYKAANAKENYWFGTDQLGRDLWTRTWKGAQISLFIGVVAAMLDIFIGVVYGAISG
    USA300_FPR3757  DGKDAYKAANAKENYWFGTDQLGRDLWTRTWKGAQISLFIGVVAAMLDIFIGVVYGAISG
                    ************************************************************

    COL             FFGGRVDTIMQRILEVIASIPNLIVVILFVLIFEPSIWTIILAMSITGWLGMSRVVRGEF
    N315            FFGGRVDTIMQRILEVIASIPNLIVVILFVLIFEPSIWTIILAMSITGWLGMSRVVRGEF
    NCTC8325        FFGGRVDTIMQRILEVIASIPNLIVVILFVLIFEPSIWTIILAMSITGWLGMSRVVRGEF
    Newman          FFGGRVDTIMQRILEVIASIPNLIVVILFVLIFEPSIWTIILAMSITGWLGMSRVVRGEF
    USA300_FPR3757  FFGGRVDTIMQRILEVIASIPNLIVVILFVLIFEPSIWTIILAMSITGWLGMSRVVRGEF
                    ************************************************************

    COL             LKLKNQEFVMASKTLGASKFKLIFKHILPNTLGAIVVTSMFTVPSAIFFEAFLSFIGIGV
    N315            LKLKNQEFVMASKTLGASKFKLIFKHILPNTLGAIVVTSMFTVPSAIFFEAFLSFIGIGV
    NCTC8325        LKLKNQEFVMASKTLGASKFKLIFKHILPNTLGAIVVTSMFTVPSAIFFEAFLSFIGIGV
    Newman          LKLKNQEFVMASKTLGASKFKLIFKHILPNTLGAIVVTSMFTVPSAIFFEAFLSFIGIGV
    USA300_FPR3757  LKLKNQEFVMASKTLGASKFKLIFKHILPNTLGAIVVTSMFTVPSAIFFEAFLSFIGIGV
                    ************************************************************

    COL             PAPQTSLGSLVNDGRAMLLIYPHELFIPAMILSLLILFFYLFSDGLRDAFDPKMRK
    N315            PAPQTSLGSLVNDGRAMLLIYPHELFIPAMILSLLILFFYLFSDGLRDAFDPKMRK
    NCTC8325        PAPQTSLGSLVNDGRAMLLIYPHELFIPAMILSLLILFFYLFSDGLRDAFDPKMRK
    Newman          PAPQTSLGSLVNDGRAMLLIYPHELFIPAMILSLLILFFYLFSDGLRDAFDPKMRK
    USA300_FPR3757  PAPQTSLGSLVNDGRAMLLIYPHELFIPAMILSLLILFFYLFSDGLRDAFDPKMRK
                    ********************************************************