From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003135000
  • symbol?: opp-3D
  • description?: oligopeptide transport system ATP-binding protein OppD-like protein

      descriptions from strain specific annotations:

    • oligopeptide transport system ATP-binding protein OppD-like protein
    • oligopeptide/dipeptide ABC transporter ATPase
    • oligopeptide transport system ATP-binding protein OppD homologue
    • oligopeptide ABC transporter, ATP-binding protein
    • Oligopeptide transport ATP-binding protein oppD
    • oligopeptide/dipeptide ABC transporter, ATP-binding , C-terminal domain protein
    • peptide ABC transporter ATP-binding protein
    • oligopeptide ABC transporter ATP-binding protein
    • putative oligopeptide transport ATP-binding protein
    • oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein
    • Oligopeptide/dipeptide ABC transporter, ATPase subunit
    • oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein, Opp3D
    • Peptide/nickel transport system ATP-binding protein
  • strand?: +
  • coordinates?: 3518562..3519644
  • synteny block?: BlockID0022270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0993 (oppD)
    N315:
    SA0847 (oppD)
    NCTC8325:
    Newman:
    NWMN_0858 (oppD)
    USA300_FPR3757:
    04-02981:
    SA2981_0943 (oppD)
    08BA02176:
    C248_1011 (oppD)
    11819-97:
    MS7_0943
    71193:
    ST398NM01_0984
    ECT-R 2:
    ECTR2_843
    ED133:
    SAOV_0934
    ED98:
    SAAV_0949 (oppD)
    HO 5096 0412:
    SAEMRSA15_08170 (oppD)
    JH1:
    SaurJH1_1006
    JH9:
    SaurJH9_0987
    JKD6008:
    SAA6008_00941 (oppD)
    JKD6159:
    SAA6159_00845 (opp3D)
    LGA251:
    SARLGA251_09040 (oppD)
    M013:
    M013TW_0910
    MRSA252:
    SAR0951 (oppD)
    MSHR1132:
    SAMSHR1132_08360
    MSSA476:
    SAS0858
    Mu3:
    SAHV_0983 (oppD)
    Mu50:
    SAV0988 (oppD)
    MW2:
    MW0870 (oppD)
    RF122:
    SAB0854 (oppD)
    ST398:
    SAPIG0984
    T0131:
    SAT0131_01021 (upp)
    TCH60:
    HMPREF0772_12257 (oppD2)
    TW20:
    SATW20_09860 (oppD)
    USA300_TCH1516:
    USA300HOU_0946 (oppD1)
    VC40:
    SAVC_04110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTERILEVNDLHVSFDITAGEVQAVRGVDFYLNKGETLAIVGESGSGKSVTTKAITKLFQ
    N315            MTERILEVNDLHVSFDITAGEVQAVRGVDFYLNKGETLAIVGESGSGKSVTTKAITKLFQ
    NCTC8325        MTERILEVNDLHVSFDITAGEVQAVRGVDFYLNKGETLAIVGESGSGKSVTTKAITKLFQ
    Newman          MTERILEVNDLHVSFDITAGEVQAVRGVDFYLNKGETLAIVGESGSGKSVTTKAITKLFQ
    USA300_FPR3757  MTERILEVNDLHVSFDITAGEVQAVRGVDFYLNKGETLAIVGESGSGKSVTTKAITKLFQ
                    ************************************************************

    COL             GDTGRIKKGEILFLGEDLAKKPENELIKLRGKDISMIFQDPMTSLNPTMQIGKQVMEPLI
    N315            GDTGRIKKGEILFLGEDLAKKPENELIKLRGKDISMIFQDPMTSLNPTMQIGKQVMEPLI
    NCTC8325        GDTGRIKKGEILFLGEDLAKKPENELIKLRGKDISMIFQDPMTSLNPTMQIGKQVMEPLI
    Newman          GDTGRIKKGEILFLGEDLAKKPENELIKLRGKDISMIFQDPMTSLNPTMQIGKQVMEPLI
    USA300_FPR3757  GDTGRIKKGEILFLGEDLAKKPENELIKLRGKDISMIFQDPMTSLNPTMQIGKQVMEPLI
                    ************************************************************

    COL             KHKNYSKAQAKKRALEILNLVGLPNAEKRFKAYPHQFSGGQRQRIVIATALACEPKVLIA
    N315            KHKNYSKAQAKKRALEILNLVGLPNAEKRFKAYPHQFSGGQRQRIVIATALACEPKVLIA
    NCTC8325        KHKNYSKAQAKKRALEILNLVGLPNAEKRFKAYPHQFSGGQRQRIVIATALACEPKVLIA
    Newman          KHKNYSKAQAKKRALEILNLVGLPNAEKRFKAYPHQFSGGQRQRIVIATALACEPKVLIA
    USA300_FPR3757  KHKNYSKAQAKKRALEILNLVGLPNAEKRFKAYPHQFSGGQRQRIVIATALACEPKVLIA
                    ************************************************************

    COL             DEPTTALDVTMQAQILDLMKELQQKIDTAIIFITHDLGVVANIADRVAVMYGGQMVETGD
    N315            DEPTTALDVTMQAQILDLMKELQQKIDTAIIFITHDLGVVANIADRVAVMYGGQMVETGD
    NCTC8325        DEPTTALDVTMQAQILDLMKELQQKIDTAIIFITHDLGVVANIADRVAVMYGGQMVETGD
    Newman          DEPTTALDVTMQAQILDLMKELQQKIDTAIIFITHDLGVVANIADRVAVMYGGQMVETGD
    USA300_FPR3757  DEPTTALDVTMQAQILDLMKELQQKIDTAIIFITHDLGVVANIADRVAVMYGGQMVETGD
                    ************************************************************

    COL             VNEIFYDPKHPYTWGLLSSMPDLSTTNDTPLLAIPGAPPDLLHPPKGDAFARRSQYALDI
    N315            VNEIFYDPKHPYTWGLLSSMPDLSTTNDTPLLAIPGAPPDLLHPPKGDAFARRSQYALDI
    NCTC8325        VNEIFYDPKHPYTWGLLSSMPDLSTTNDTPLLAIPGAPPDLLHPPKGDAFARRSQYALDI
    Newman          VNEIFYDPKHPYTWGLLSSMPDLSTTNDTPLLAIPGAPPDLLHPPKGDAFARRSQYALDI
    USA300_FPR3757  VNEIFYDPKHPYTWGLLSSMPDLSTTNDTPLLAIPGAPPDLLHPPKGDAFARRSQYALDI
                    ************************************************************

    COL             DFKVEPPWFKVSPTHFVKSWLLDARAPKVELPELVKQRMKPMPNNYEKPLKVERVSFNEK
    N315            DFKVEPPWFKVSPTHFVKSWLLDARAPKVELPELVKQRMKPMPNNYEKPLKVERVSFNEK
    NCTC8325        DFKVEPPWFKVSPTHFVKSWLLDARAPKVELPELVKQRMKPMPNNYEKPLKVERVSFNEK
    Newman          DFKVEPPWFKVSPTHFVKSWLLDARAPKVELPELVKQRMKPMPNNYEKPLKVERVSFNEK
    USA300_FPR3757  DFKVEPPWFKVSPTHFVKSWLLDARAPKVELPELVKQRMKPMPNNYEKPLKVERVSFNEK
                    ************************************************************