From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003136000
  • symbol?: opp-3F
  • description?: oligopeptide transport system ATP-binding protein OppF-like protein

      descriptions from strain specific annotations:

    • oligopeptide transport system ATP-binding protein OppF-like protein
    • oligopeptide ABC transporter ATP-binding protein
    • oligopeptide transport system ATP-binding protein OppF homologue
    • oligopeptide ABC transporter, ATP-binding protein
    • putative oligopeptide transport ATP-bindingprotein
    • Oligopeptide transport ATP-binding protein oppF
    • oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter-like protein
    • oligopeptide transport ATP-binding protein
    • oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein, Opp3F
    • ABC transporter family protein
    • Oligopeptide transport system ATP-binding protein
    • pseudogene
  • strand?: +
  • coordinates?: 3519634..3520575
  • synteny block?: BlockID0022280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0994 (oppF)
    N315:
    SA0848 (oppF)
    NCTC8325:
    Newman:
    NWMN_0859 (oppF)
    USA300_FPR3757:
    04-02981:
    SA2981_0944 (oppF)
    08BA02176:
    C248_1012 (oppF)
    11819-97:
    MS7_0944
    71193:
    ST398NM01_0985
    ECT-R 2:
    ECTR2_844 (oppF)
    ED133:
    SAOV_0935
    ED98:
    SAAV_0950 (oppF)
    HO 5096 0412:
    SAEMRSA15_08180 (oppF)
    JH1:
    SaurJH1_1007
    JH9:
    SaurJH9_0988
    JKD6008:
    SAA6008_00942 (oppF)
    JKD6159:
    SAA6159_00846 (opp3F)
    LGA251:
    SARLGA251_09050 (oppF)
    M013:
    M013TW_0911
    MRSA252:
    SAR0952 (oppF)
    MSHR1132:
    SAMSHR1132_08370
    MSSA476:
    SAS0859
    Mu3:
    SAHV_0984 (oppF)
    Mu50:
    SAV0989 (oppF)
    MW2:
    MW0871 (oppF)
    RF122:
    SAB0855 (oppF)
    ST398:
    SAPIG0985
    T0131:
    SAT0131_01022 (glyA)
    TCH60:
    HMPREF0772_12256 (oppF3)
    TW20:
    SATW20_09870 (oppF)
    USA300_TCH1516:
    USA300HOU_0947 (oppF1)
    VC40:
    SAVC_04115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNDEVLLSIKNLKQYFNAGKKNEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIK
    N315            MKNDEVLLSIKNLKQYFNAGKKNEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIK
    NCTC8325        MKNDEVLLSIKNLKQYFNAGKKNEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIK
    Newman          MKNDEVLLSIKNLKQYFNAGKKNEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIK
    USA300_FPR3757  MKNDEVLLSIKNLKQYFNAGKKNEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIK
                    ************************************************************

    COL             LNDITSGEILYEGIDIQKIRKRKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIH
    N315            LNDITSGEILYEGIDIQKIRKRKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIH
    NCTC8325        LNDITSGEILYEGIDIQKIRKRKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIH
    Newman          LNDITSGEILYEGIDIQKIRKRKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIH
    USA300_FPR3757  LNDITSGEILYEGIDIQKIRKRKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIH
                    ************************************************************

    COL             HLATDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARVLAVEPEFIIADEP
    N315            HLATDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARALAVEPEFIIADEP
    NCTC8325        HLATDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARALAVEPEFIIADEP
    Newman          HLATDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARVLAVEPEFIIADEP
    USA300_FPR3757  HLATDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARALAVEPEFIIADEP
                    **********************************************.*************

    COL             ISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEE
    N315            ISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEE
    NCTC8325        ISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEE
    Newman          ISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEE
    USA300_FPR3757  ISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEE
                    ************************************************************

    COL             IYQNPLHDYTKSLLSAIPQPDPESERSRKRFSYIDDEANNHLRQLHEIRPNHFVFSTEEE
    N315            IYQNPLHDYTKSLLSAIPQPDPESERSRKRFSYIDDEANNHLRQLHEIRPNHFVFSTEEE
    NCTC8325        IYQNPLHDYTKSLLSAIPQPDPESERSRKRFSYIDDEANNHLRQLHEIRPNHFVFSTEEE
    Newman          IYQNPLHDYTKSLLSAIPQPDPESERSRKRFSYIDDEANNHLRQLHEIRPNHFVFSTEEE
    USA300_FPR3757  IYQNPLHDYTKSLLSAIPQPDPESERSRKRFSYIDDEANNHLRQLHEIRPNHFVFSTEEE
                    ************************************************************

    COL             AAQLRENKLVTQN
    N315            AAQLRENKLVTQN
    NCTC8325        AAQLRENKLVTQN
    Newman          AAQLRENKLVTQN
    USA300_FPR3757  AAQLRENKLVTQN
                    *************