From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003151000
  • symbol?: opp-4F
  • description?: oligopeptide ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • oligopeptide ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein
    • peptide ABC transporter substrate-binding protein
    • Oligopeptide transport ATP-binding protein oppF
    • putative oligopeptide transport ATP-binding protein
    • oligopeptide/dipeptide ABC transporter, ATP-binding , C-terminal domain protein
    • oligopeptide/dipeptide ABC transporter ATPase
    • oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein
    • oligopeptide ABC transporter, ATP-binding protein
    • oligopeptide transport ATP-binding protein appF
    • oligopeptide transport system ATP-binding protein AppF homologue
    • oligopeptide transport system ATP-binding protein AppF-like protein
  • strand?: +
  • coordinates?: 3535620..3536684
  • synteny block?: BlockID0022400
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0852 (appF)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0948 (oppF)
    08BA02176:
    11819-97:
    MS7_0949
    71193:
    ECT-R 2:
    ECTR2_848
    ED133:
    SAOV_0939
    ED98:
    SAAV_0954
    HO 5096 0412:
    SAEMRSA15_08220 (appF)
    JH1:
    SaurJH1_1011
    JH9:
    SaurJH9_0992
    JKD6008:
    SAA6008_00946
    JKD6159:
    LGA251:
    SARLGA251_09090 (appF)
    M013:
    M013TW_0915
    MRSA252:
    SAR0958 (appF)
    MSHR1132:
    SAMSHR1132_08410
    MSSA476:
    SAS0863
    Mu3:
    SAHV_0988 (appF)
    Mu50:
    SAV0993 (appF)
    MW2:
    MW0875 (appF)
    RF122:
    ST398:
    T0131:
    SAT0131_01026
    TCH60:
    HMPREF0772_12248 (oppF2)
    TW20:
    SATW20_09910 (appF)
    USA300_TCH1516:
    USA300HOU_0951 (oppD3)
    VC40:
    SAVC_04135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENILEVNQIKKYYKIKTGLLQKTQYVKAVDDVSFSIKKGQTFGLVGESGCGKSTLGKVI
    N315            MENILEVNQIKKYYKIKTGLLQKTQYVKAVDDVSFSIKKGQTFGLVGESGCGKSTLGKVI
    NCTC8325        MENILEVNQIKKYYKIKTGLLQKTQYVKAVDDVSFSIKKGQTFGLVGESGCGKSTLGKVI
    Newman          MENILEVNQIKKYYKIKTGLLQKTQYVKAVDDVSFSIKKGQTFGLVGESGCGKSTLGKVI
    USA300_FPR3757  MENILEVNQIKKYYKIKTGLLQKTQYVKAVDDVSFSIKKGQTFGLVGESGCGKSTLGKVI
                    ************************************************************

    COL             IRLEDATSGSIIVNGEDITRLQGKKLRKSRQQYQMIFQDPYASLNPMQMVGDIISEPILN
    N315            IRLEDATSGSIIVNGEDITRLQGKKLRKSRQQYQMIFQDPYASLNPMQMVGDIISEPILN
    NCTC8325        IRLEDATSGSIIVNGEDITRLQGKKLRKSRQQYQMIFQDPYASLNPMQMVGDIISEPILN
    Newman          IRLEDATSGSIIVNGEDITRLQGKKLRKSRQQYQMIFQDPYASLNPMQMVGDIISEPILN
    USA300_FPR3757  IRLEDATSGSIIVNGEDITRLQGKKLRKSRQQYQMIFQDPYASLNPMQMVGDIISEPILN
                    ************************************************************

    COL             YKKLPKEEIKKEVLYLLKCVGLSEDAYYKYAHEFSGGQRQRVGIARALALRPSLIVADEP
    N315            YKKLPKEEIKKEVLYLLKCVGLSEDAYYKYAHEFSGGQRQRVGIARALALRPSLIVADEP
    NCTC8325        YKKLPKEEIKKEVLYLLKCVGLSEDAYYKYAHEFSGGQRQRVGIARALALRPSLIVADEP
    Newman          YKKLPKEEIKKEVLYLLKCVGLSEDAYYKYAHEFSGGQRQRVGIARALALRPSLIVADEP
    USA300_FPR3757  YKKLPKEEIKKEVLYLLKCVGLSEDAYYKYAHEFSGGQRQRVGIARALALRPSLIVADEP
                    ************************************************************

    COL             VSALDVSVQSQVLNLLKDLQEQFNLSYLFIAHDLSVVKHISDVIGVMYLGHIVEIASDKE
    N315            VSALDVSVQSQVLNLLKDLQEQFKLSYLFIAHDLSVVKHISDVIGVMYLGHIVEIASDKE
    NCTC8325        VSALDVSVQSQVLNLLKDLQEQFNLSYLFIAHDLSVVKHISDVIGVMYLGHIVEIASDKE
    Newman          VSALDVSVQSQVLNLLKDLQEQFNLSYLFIAHDLSVVKHISDVIGVMYLGHIVEIASDKE
    USA300_FPR3757  VSALDVSVQSQVLNLLKDLQEQFNLSYLFIAHDLSVVKHISDVIGVMYLGHIVEIASDKE
                    ***********************:************************************

    COL             IYENPKHPYTKALISSIPQIDKHNNNRIILKGELPSPSNPPQGCPFHTRCPIAQDMCKKS
    N315            IYENPKHPYTKALISSIPQIDKHNNNRIILKGELPSPSNPPQGCPFHTRCPIAKDKCKEN
    NCTC8325        IYENPKHPYTKALISSIPQIDKHNNNRIILKGELPSPSNPPQGCPFHTRCPIAQDMCKKS
    Newman          IYENPKHPYTKALISSIPQIDKHNNNRIILKGELPSPSNPPQGCPFHTRCPIAQDMCKKS
    USA300_FPR3757  IYENPKHPYTKALISSIPQIDKHNNNRIILKGELPSPSNPPQGCPFHTRCPIAQDMCKKS
                    *****************************************************:* **:.

    COL             MPELKDIGNEHQVACFYVDKVGDLND
    N315            IPQLKDIGNEHQVACFYVDKVGDLNA
    NCTC8325        MPELKDIGNEHQVACFYVDKVGDLND
    Newman          MPELKDIGNEHQVACFYVDKVGDLND
    USA300_FPR3757  MPELKDIGNEHQVACFYVDKVGDLND
                    :*:**********************