From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003168000
  • symbol?: trfA
  • description?: adaptor protein MecA

      descriptions from strain specific annotations:

    • adaptor protein MecA
    • adaptor protein
    • adapter protein mecA
    • Negative regulator of genetic competence MecA
    • genetic competence repressor
    • negative regulator of genetic competence (MecA) family protein
    • negative regulator of genetic competence family protein
    • putative negative regulator of genetic competence
    • regulatory protein
  • strand?: +
  • coordinates?: 3561029..3561748
  • synteny block?: BlockID0022550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0953
    08BA02176:
    C248_1021
    11819-97:
    MS7_0954
    71193:
    ST398NM01_0994
    ECT-R 2:
    ECTR2_853
    ED133:
    SAOV_0944
    ED98:
    SAAV_0961
    HO 5096 0412:
    SAEMRSA15_08290
    JH1:
    SaurJH1_1016
    JH9:
    SaurJH9_0997
    JKD6008:
    SAA6008_00951 (mecA2)
    JKD6159:
    SAA6159_00855 (mecA2)
    LGA251:
    SARLGA251_09140
    M013:
    M013TW_0921
    MRSA252:
    SAR0966
    MSHR1132:
    SAMSHR1132_08460
    MSSA476:
    SAS0868
    Mu3:
    SAHV_0993
    Mu50:
    SAV0998
    MW2:
    MW0880
    RF122:
    SAB0865
    ST398:
    SAPIG0994
    T0131:
    SAT0131_01033
    TCH60:
    HMPREF0772_12238 (mecA2)
    TW20:
    SATW20_09960
    USA300_TCH1516:
    USA300HOU_0956 (mecA2)
    VC40:
    SAVC_04160

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPL
    N315            MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPL
    NCTC8325        MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPL
    Newman          MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPL
    USA300_FPR3757  MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPL
                    ************************************************************

    COL             WIQVHAFDKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQR
    N315            WIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQR
    NCTC8325        WIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQR
    Newman          WIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQR
    USA300_FPR3757  WIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQR
                    *******:****************************************************

    COL             TKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYY
    N315            TKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYY
    NCTC8325        TKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYY
    Newman          TKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYY
    USA300_FPR3757  TKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYY
                    ************************************************************

    COL             AVYFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE
    N315            AVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE
    NCTC8325        AVYFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE
    Newman          AVYFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE
    USA300_FPR3757  AVYFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE
                    **:********************************************************