From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003171000
  • symbol?: pepF
  • description?: thimet oligopeptidase-like protein

      descriptions from strain specific annotations:

    • thimet oligopeptidase-like protein
    • thimet oligopeptidase homologue
    • oligoendopeptidase F
    • putative oligopeptidase
    • M03 family oligopeptidase F
  • strand?: +
  • coordinates?: 3562972..3564780
  • synteny block?: BlockID0022580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1005 (pepF)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0955
    08BA02176:
    C248_1023 (pepB)
    11819-97:
    MS7_0956
    71193:
    ST398NM01_0996
    ECT-R 2:
    ECTR2_855 (pepF)
    ED133:
    SAOV_0946
    ED98:
    SAAV_0963 (pepF)
    HO 5096 0412:
    SAEMRSA15_08310 (pepB)
    JH1:
    SaurJH1_1018
    JH9:
    SaurJH9_0999
    JKD6008:
    SAA6008_00954
    JKD6159:
    SAA6159_00857
    LGA251:
    SARLGA251_09160 (pepB)
    M013:
    M013TW_0923
    MRSA252:
    SAR0968 (pepB)
    MSHR1132:
    SAMSHR1132_08480
    MSSA476:
    SAS0870
    Mu3:
    SAHV_0995
    Mu50:
    SAV1000
    MW2:
    MW0882
    RF122:
    SAB0867 (pepB)
    ST398:
    SAPIG0996 (pepF)
    T0131:
    SAT0131_01036
    TCH60:
    HMPREF0772_12236 (pepF2)
    TW20:
    SATW20_09980 (pepB)
    USA300_TCH1516:
    USA300HOU_0958
    VC40:
    SAVC_04170

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQQLSREEQERKYPEYTWDLTTIFKDDEAFEAAFKEVENELGKEEQFKGHIGDSAETLY
    N315            MSQQLSREEQERKYPEYTWDLTTIFKDDEAFEAAFKEVENELGKEEQFKGHIGDSAETLY
    NCTC8325        MSQQLSREEQERKYPEYTWDLTTIFKDDEAFEAAFKEVENELGKEEQFKGHIGDSAETLY
    Newman          MSQQLSREEQERKYPEYTWDLTTIFKDDEAFEAAFKEVENELGKEEQFKGHIGDSAETLY
    USA300_FPR3757  MSQQLSREEQERKYPEYTWDLTTIFKDDEAFEAAFKEVENELGKEEQFKGHIGDSAETLY
                    ************************************************************

    COL             NALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWSFLVPEILQ
    N315            NALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWSFLVPEILQ
    NCTC8325        NALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWSFLVPEILQ
    Newman          NALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWSFLVPEILQ
    USA300_FPR3757  NALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWSFLVPEILQ
                    ************************************************************

    COL             IDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTPSNVYGMFS
    N315            IDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTPSNVYGMFS
    NCTC8325        IDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTPSNVYGMFS
    Newman          IDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTPSNVYGMFS
    USA300_FPR3757  IDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTPSNVYGMFS
                    ************************************************************

    COL             NADLVFEDAIDKDGNAHPLTQGTFIKYLETDDRKLRESAFRNVYKAYGAHNNTLGATLAG
    N315            NADLVFEDAIDKDGNAHPLTQGTFIKYLESDDRKLRESAFRNVYKAYGAHNNTLGATLAG
    NCTC8325        NADLVFEDAIDKDGNAHPLTQGTFIKYLETDDRKLRESAFRNVYKAYGAHNNTLGATLAG
    Newman          NADLVFEDAIDKDGNAHPLTQGTFIKYLETDDRKLRESAFRNVYKAYGAHNNTLGATLAG
    USA300_FPR3757  NADLVFEDAIDKDGNAHPLTQGTFIKYLETDDRKLRESAFRNVYKAYGAHNNTLGATLAG
                    *****************************:******************************

    COL             EVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKYLPLLHRYTELRKELLGLD
    N315            EVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKYLPLLHRYTELRKELLGLD
    NCTC8325        EVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKYLPLLHRYTELRKELLGLD
    Newman          EVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKYLPLLHRYTELRKELLGLD
    USA300_FPR3757  EVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKYLPLLHRYTELRKELLGLD
                    ************************************************************

    COL             DLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRWVDVYENKGK
    N315            DLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRWVDVYENKGK
    NCTC8325        DLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRWVDVYENKGK
    Newman          DLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRWVDVYENKGK
    USA300_FPR3757  DLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRWVDVYENKGK
                    ************************************************************

    COL             RSGGYSSGAHLTNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSNSSDYTIFVAE
    N315            RSGGYSSGAHLTNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSNSSDYTIFVAE
    NCTC8325        RSGGYSSGAHLTNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSNSSDYTIFVAE
    Newman          RSGGYSSGAHLTNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSNSSDYTIFVAE
    USA300_FPR3757  RSGGYSSGAHLTNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSNSSDYTIFVAE
                    ************************************************************

    COL             VASTCNEALLSDYMDKHLDDEKRLLLLNQELERFRATLFRQTMFAEFEHKIHAIEEAGEP
    N315            VASTCNEALLSDYMDKHLDDEKRLLLLNQELERFRATLFRQTMFAEFEHKIHAIEEAGEP
    NCTC8325        VASTCNEALLSDYMDKHLDDEKRLLLLNQELERFRATLFRQTMFAEFEHKIHAIEEAGEP
    Newman          VASTCNEALLSDYMDKHLDDEKRLLLLNQELERFRATLFRQTMFAEFEHKIHAIEEAGEP
    USA300_FPR3757  VASTCNEALLSDYMDKHLDDEKRLLLLNQELERFRATLFRQTMFAEFEHKIHAIEEAGEP
                    ************************************************************

    COL             LTPTRMNEEYAKLNKLYFGDSVETDEDISKEWSRIPHFYMNYYVYQYATGYSAAQSLSHQ
    N315            LTPTRMNEEYAKLNKLYFGDSVETDEDISKEWSRIPHFYMNYYVYQYATGYSAAQSLSHQ
    NCTC8325        LTPTRMNEEYAKLNKLYFGDSVETDEDISKEWSRIPHFYMNYYVYQYATGYSAAQSLSHQ
    Newman          LTPTRMNEEYAKLNKLYFGDSVETDEDISKEWSRIPHFYMNYYVYQYATGYSAAQSLSHQ
    USA300_FPR3757  LTPTRMNEEYAKLNKLYFGDSVETDEDISKEWSRIPHFYMNYYVYQYATGYSAAQSLSHQ
                    ************************************************************

    COL             ILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACEVFEQKLNAFEKLM
    N315            ILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACEVFEQKLNAFEKLM
    NCTC8325        ILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACEVFEQKLNAFEKLM
    Newman          ILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACEVFEQKLNAFEKLM
    USA300_FPR3757  ILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACEVFEQKLNAFEKLM
                    ************************************************************

    COL             KA
    N315            KA
    NCTC8325        KA
    Newman          KA
    USA300_FPR3757  KA
                    **