From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003173000
  • symbol?: yjbH
  • description?: YjbH-like, GTP pyrophosphokinase domain protein

      descriptions from strain specific annotations:

    • YjbH-like, GTP pyrophosphokinase domain protein
    • putative dithiol-disulfide isomerase
    • YjbH-like, GTP pyrophosphokinase domain-containing protein
    • protein (Fragment)
  • strand?: -
  • coordinates?: 3565440..3566225
  • synteny block?: BlockID0022600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0956 (yjbH)
    08BA02176:
    C248_1024
    11819-97:
    MS7_0957
    71193:
    ST398NM01_0997
    ECT-R 2:
    ECTR2_856
    ED133:
    SAOV_0947c
    ED98:
    SAAV_0964
    HO 5096 0412:
    SAEMRSA15_08320
    JH1:
    SaurJH1_1019
    JH9:
    SaurJH9_1000
    JKD6008:
    SAA6008_00955
    JKD6159:
    SAA6159_00858
    LGA251:
    SARLGA251_09170
    M013:
    M013TW_0924
    MRSA252:
    SAR0969
    MSHR1132:
    SAMSHR1132_08490
    MSSA476:
    SAS0871
    Mu3:
    SAHV_0996 (yjbM)
    Mu50:
    SAV1001 (yjbM)
    MW2:
    MW0883
    RF122:
    SAB0868c
    ST398:
    SAPIG0997
    T0131:
    SAT0131_01037
    TCH60:
    HMPREF0772_12235
    TW20:
    SATW20_09990
    USA300_TCH1516:
    USA300HOU_0959
    VC40:
    SAVC_04175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAGELRIMENKSREDINLSPVSKIEIYSFFDPFSSDCFKLSAILSKLRIEYNQYIRIRHI
    N315            -------MENKSREDINLSPVSKIEIYSFFDPFSSDCFKLSAILSKLRIEYNQYIRIRHI
    NCTC8325        MAGELRIMENKSREDINLSPVSKIEIYSFFDPFSSDCFKLSAILSKLRIEYNQYIRIRHI
    Newman          MAGELRIMENKSREDINLSPVSKIEIYSFFDPFSSDCFKLSAILSKLRIEYNQYIRIRHI
    USA300_FPR3757  MAGELRIMENKSREDINLSPVSKIEIYSFFDPFSSDCFKLSAILSKLRIEYNQYIRIRHI
                           *****************************************************

    COL             LNPSLKVLTKCQAQSTSNFDNIALAYKAAELQGRVRVERFIHLMQNEIIPKRDIITESMI
    N315            LNPSLKVLTKCQAQSTSNFDNIALAYKAAELQGRVRAERFIHLMQNEIIPKRDIITESMI
    NCTC8325        LNPSLKVLTKCQAQSTSNFDNIALAYKAAELQGRVRAERFIHLMQNEIIPKRDIITESMI
    Newman          LNPSLKVLTKCQAQSTSNFDNIALAYKAAELQGRVRAERFIHLMQNEIIPKRDIITESMI
    USA300_FPR3757  LNPSLKVLTKCQAQSTSNFDNIALAYKAAELQGRVRAERFIHLMQNEIIPKRDIITESMI
                    ************************************.***********************

    COL             CDCIQNAGIDLEVFKDDLQKSKLTESLKIDLHIAREMEIEQAPSLVFFSEDVHEEGLKVE
    N315            CDCIQNAGIDLEVFKDDLQKSKLTESLKIDLHIAREMEIEQAPSLVFFSEDVHEEGLKVE
    NCTC8325        CDCIQNAGIDLEVFKDDLQKSKLTESLKIDLHIAREMEIEQAPSLVFFSEDVHEEGLKVE
    Newman          CDCIQNAGIDLEVFKDDLQKSKLTESLKIDLHIAREMEIEQAPSLVFFSEDVHEEGLKVE
    USA300_FPR3757  CDCIQNAGIDLEVFKDDLQKSKLTESLKIDLHIAREMEIEQAPSLVFFSEDVHEEGLKVE
                    ************************************************************

    COL             GLYPYHIYTYIINELMGKPIEKNLPPKLETYIQQQQLVTMEELLTIYEWPEKLLNKELKK
    N315            GLYPYHIYTYIINELMGKPIEKNLPPKLETYIQQQQLVTMEELLTIYEWPEKLLNKELKK
    NCTC8325        GLYPYHIYTYIINELMGKPIEKNLPPKLETYIQQQQLVTMEELLTIYEWPEKLLNKELKK
    Newman          GLYPYHIYTYIINELMGKPIEKNLPPKLETYIQQQQLVTMEELLTIYEWPEKLLNKELKK
    USA300_FPR3757  GLYPYHIYTYIINELMGKPIEKNLPPKLETYIQQQQLVTMEELLTIYEWPEKLLNKELKK
                    ************************************************************

    COL             LAIQQKIEKLKYPDGDFWKSKMPKIKSK
    N315            LAIQQKIEKLKYPDGDFWKSKMPKIKSK
    NCTC8325        LAIQQKIEKLKYPDGDFWKSKMPKIKSK
    Newman          LAIQQKIEKLKYPDGDFWKSKMPKIKSK
    USA300_FPR3757  LAIQQKIEKLKYPDGDFWKSKMPKIKSK
                    ****************************