From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003174000
  • symbol?:
  • description?: globin

      descriptions from strain specific annotations:

    • globin
    • Hemoglobin-like protein HbO
    • bacterial-like globin family protein
    • protozoan/cyanobacterial globin family protein
  • strand?: -
  • coordinates?: 3566269..3566586
  • synteny block?: BlockID0022610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0957 (hbo)
    08BA02176:
    C248_1025
    11819-97:
    MS7_0958
    71193:
    ST398NM01_0998
    ECT-R 2:
    ECTR2_857
    ED133:
    SAOV_0948c
    ED98:
    SAAV_0965
    HO 5096 0412:
    SAEMRSA15_08330
    JH1:
    SaurJH1_1020
    JH9:
    SaurJH9_1001
    JKD6008:
    SAA6008_00956
    JKD6159:
    SAA6159_00859
    LGA251:
    SARLGA251_09180
    M013:
    M013TW_0925
    MRSA252:
    SAR0970
    MSHR1132:
    SAMSHR1132_08500
    MSSA476:
    SAS0872
    Mu3:
    SAHV_0997
    Mu50:
    SAV1003
    MW2:
    MW0884
    RF122:
    SAB0869c
    ST398:
    SAPIG0998
    T0131:
    SAT0131_01038
    TCH60:
    HMPREF0772_12234
    TW20:
    SATW20_10000
    USA300_TCH1516:
    USA300HOU_0960
    VC40:
    SAVC_04180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIY
    N315            MTTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIY
    NCTC8325        ----------------MIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIY
    Newman          MTTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIY
    USA300_FPR3757  MTTTPYDIIGKEALYDMIHYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIY
                                    **.*****************************************

    COL             TEEHGHPMLRKRHIDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVN
    N315            TEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVN
    NCTC8325        TEEHGHPMLRKRHIDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVN
    Newman          TEEHGHPMLRKRHIDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVN
    USA300_FPR3757  TEEHGHPMLRKRHIDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVN
                    *************:**********************************************

    COL             S
    N315            S
    NCTC8325        S
    Newman          S
    USA300_FPR3757  S
                    *