From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003175000
  • symbol?:
  • description?: adenylate cyclase

      descriptions from strain specific annotations:

    • adenylate cyclase
    • adenylate cyclase family protein
    • CYTH domain-containing protein
    • Organic phosphate binding CYTH family protein
    • putative adenylate cyclase
  • strand?: -
  • coordinates?: 3566756..3567349
  • synteny block?: BlockID0022620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0958
    08BA02176:
    C248_1026
    11819-97:
    MS7_0959
    71193:
    ST398NM01_0999
    ECT-R 2:
    ECTR2_858
    ED133:
    SAOV_0949c
    ED98:
    SAAV_0966
    HO 5096 0412:
    SAEMRSA15_08340
    JH1:
    SaurJH1_1021
    JH9:
    SaurJH9_1002
    JKD6008:
    SAA6008_00957
    JKD6159:
    SAA6159_00860
    LGA251:
    SARLGA251_09190
    M013:
    M013TW_0926
    MRSA252:
    SAR0971
    MSHR1132:
    SAMSHR1132_08510
    MSSA476:
    SAS0873
    Mu3:
    SAHV_0998
    Mu50:
    SAV1004
    MW2:
    MW0885
    RF122:
    SAB0870c
    ST398:
    SAPIG0999
    T0131:
    SAT0131_01039
    TCH60:
    HMPREF0772_12233 (cyaA)
    TW20:
    SATW20_10010
    USA300_TCH1516:
    USA300HOU_0961
    VC40:
    SAVC_04185

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MATNHEIEFKQMITASIYNKLQEKYFKDSVLFKQVNYYIDTPDFKLKEHRSALRIRVKDN
    N315            MATNHEIEFKQMITASIYNKLQEKYFKDSVLFKQVNYYIDTPDFKLKEHRSALRIRVKDN
    NCTC8325        MATNHEIEFKQMITASIYNKLQEKYFKDSVLFKQVNYYIDTPDFKLKEHRSALRIRVKDN
    Newman          MATNHEIEFKQMITASIYNKLQEKYFKDSVLFKQVNYYIDTPDFKLKEHRSALRIRVKDN
    USA300_FPR3757  MATNHEIEFKQMITASIYNKLQEKYFKDSVLFKQVNYYIDTPDFKLKEHRSALRIRVKDN
                    ************************************************************

    COL             QYEMTLKTPAKVGLLEYNYIVDIKPEMNLIISNDNLPDDIRQIIVEQFGVKDTTLSILGA
    N315            QYEMTLKTPAKVGLLEYNYIVDIKPEMNLIISNDNLPDDIRQIIVEQFGVKDTTLSILGA
    NCTC8325        QYEMTLKTPAKVGLLEYNYIVDIKPEMNLIISNDNLPDDIRQIIVEQFGVKDTTLSILGA
    Newman          QYEMTLKTPAKVGLLEYNYIVDIKPEMNLIISNDNLPDDIRQIIVEQFGVKDTTLSILGA
    USA300_FPR3757  QYEMTLKTPAKVGLLEYNYIVDIKPEMNLIISNDNLPDDIRQIIVEQFGVKDTTLSILGA
                    ************************************************************

    COL             LTTYRQETKYKGDLLVLDKSEYFDTTDYELEFEVKDYNQGLQKFQSLLNELNLEHHQPLN
    N315            LTTYRQETKYKGDLLVLDKSEYFDTADYELEFEVKDYNQGLQKFQSLLNELNLEHHQPLN
    NCTC8325        LTTYRQETKYKGDLLVLDKSEYFDTTDYELEFEVKDYNQGLQKFQSLLNELNLEHHQPLN
    Newman          LTTYRQETKYKGDLLVLDKSEYFDTTDYELEFEVKDYNQGLQKFQSLLNELNLEHHQPLN
    USA300_FPR3757  LTTYRQETKYKGDLLVLDKSEYFDTTDYELEFEVKDYNQGLQKFQSLLNELNLEHHQPLN
                    *************************:**********************************

    COL             KVQRFFKKKETLSNNIN
    N315            KVQRFFKKKETLSNNIN
    NCTC8325        KVQRFFKKKETLSNNIN
    Newman          KVQRFFKKKETLSNNIN
    USA300_FPR3757  KVQRFFKKKETLSNNIN
                    *****************