From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003176000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3567499..3567882
  • synteny block?: BlockID0022630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0959
    08BA02176:
    C248_1027
    11819-97:
    MS7_0960
    71193:
    ST398NM01_1000
    ECT-R 2:
    ECTR2_859
    ED133:
    SAOV_0950
    ED98:
    SAAV_0967
    HO 5096 0412:
    SAEMRSA15_08350
    JH1:
    SaurJH1_1022
    JH9:
    SaurJH9_1003
    JKD6008:
    SAA6008_00958
    JKD6159:
    SAA6159_00861
    LGA251:
    SARLGA251_09200
    M013:
    M013TW_0927
    MRSA252:
    SAR0972
    MSHR1132:
    SAMSHR1132_08520
    MSSA476:
    SAS0874
    Mu3:
    SAHV_0999
    Mu50:
    SAV1005
    MW2:
    MW0886
    RF122:
    SAB0871
    ST398:
    SAPIG1000
    T0131:
    SAT0131_01040
    TCH60:
    HMPREF0772_12232
    TW20:
    SATW20_10020
    USA300_TCH1516:
    USA300HOU_0962
    VC40:
    SAVC_04190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRLYINEIKIKDDILYCYTEDSIKGLSEVGQMLVDSDNYAFAYTLDDGKAYAYLIFVQET
    N315            MRLYINEIKIKDDILYCYTEDSIKGLSEVGQMLVDSDNYAFAYTLDDGKAYAYLIFVQET
    NCTC8325        MRLYINEIKIKDDILYCYTEDSIKGLSEVGQMLVDSDNYAFAYTLDDGKAYAYLIFVQET
    Newman          MRLYINEIKIKDDILYCYTEDSIKGLSEVGQMLVDSDNYAFAYTLDDGKAYAYLIFVQET
    USA300_FPR3757  MRLYINEIKIKDDILYCYTEDSIKGLSEVGQMLVDSDNYAFAYTLDDGKAYAYLIFVQET
                    ************************************************************

    COL             WTMLHENMTKKIIINDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
    N315            WTMLHENTTKKIIINDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
    NCTC8325        WTMLHENMTKKIIINDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
    Newman          WTMLHENMTKKIIINDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
    USA300_FPR3757  WTMLHENMTKKIIINDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
                    ******* ***********************************************