From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003181000
  • symbol?: cpaA
  • description?: Na+/H+ antiporter-like protein

      descriptions from strain specific annotations:

    • Na+/H+ antiporter-like protein
    • transporter, monovalent cation:proton antiporter-2 (CPA2) family protein
    • sodium/hydrogen exchanger
    • monovalent cation/H+ antiporter-2 (CPA2) family protein
    • Na+/H+ antiporter homologue
    • CPA2 family monovalent cation:proton (H+) antiporter-2
    • putative cation transport protein
    • sodium/hydrogen exchanger family protein
    • pseudogene
    • Na+/H+ antiporter protein
    • monovalent cation antiporter-2
  • strand?: +
  • coordinates?: 3571628..3573472
  • synteny block?: BlockID0022680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0964
    08BA02176:
    C248_1032
    11819-97:
    MS7_0965
    71193:
    ST398NM01_1005
    ECT-R 2:
    ECTR2_864
    ED133:
    SAOV_0955
    ED98:
    SAAV_0972
    HO 5096 0412:
    SAEMRSA15_08400
    JH1:
    SaurJH1_1027
    JH9:
    SaurJH9_1008
    JKD6008:
    SAA6008_00963
    JKD6159:
    SAA6159_00866
    LGA251:
    SARLGA251_09250
    M013:
    M013TW_0932
    MRSA252:
    SAR0977
    MSHR1132:
    SAMSHR1132_08570
    MSSA476:
    SAS0879
    Mu3:
    SAHV_1004
    Mu50:
    SAV1010
    MW2:
    MW0891
    RF122:
    SAB0876
    ST398:
    SAPIG1005
    T0131:
    SAT0131_01045
    TCH60:
    HMPREF0772_12227
    TW20:
    SATW20_10070
    USA300_TCH1516:
    USA300HOU_0967
    VC40:
    SAVC_04215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MEFLSLVIVVLAAFLTPIIVNRLNINFLPVVVAEILMGIVIGNSFLNIVERDSILNILST
    NCTC8325        MEFLSLVIVVLAAFLTPIIVNRLNINFLPVVVAEILMGIVIGNSFLNIVERDSILNILST
    Newman          MEFLSLVIVVLAAFLTPIIVNRLNINFLPVVVAEILMGIVIGNSFLNIVERDSILNILST
    USA300_FPR3757  MEFLSLVIVVLAAFLTPIIVNRLNINFLPVVVAEILMGIVIGNSFLNIVERDSILNILST
                    ************************************************************

    N315            LGFIFLMFLSGLEIDFKAFKKDKRARQGQNDDESSIPGHLNLALTVFAFIMIISILLAYV
    NCTC8325        LGFIFLMFLSGLEIDFKAFKKDKRARQGQNDDESSIPGHLNLALTVFAFIMIISILLAYV
    Newman          LGFIFLMFLSGLEIDFKAFKKDKRARQGQNDDESSIPGHLNLALTVFAFIMIISILLAYV
    USA300_FPR3757  LGFIFLMFLSGLEIDFKAFKKDKRARQGQNDDESSIPGHLNLALTVFAFIMIISILLAYV
                    ************************************************************

    N315            FKWLGLVDDVLLMVIIISTISLGVVVPTLKEMNIMRTTIGQFILLVAVLADLVTMILLTV
    NCTC8325        FKWLGLVDDVLLMVIIISTISLGVVVPTLKEMNIMRTTIGQFILLVAVLADLVTMILLTV
    Newman          FKWLGLVDDVLLMVIIISTISLGVVVPTLKEMNIMRTTIGQFILLVAVLADLVTMILLTV
    USA300_FPR3757  FKWLGLVDDVLLMVIIISTISLGVVVPTLKEMNIMRTTIGQFILLVAVLADLVTMILLTV
                    ************************************************************

    N315            YGAINGQGGSTIWLIGILVVFTAISYILGVQFKRMSFLQKLMDGTTQIGIRAVFALIILL
    NCTC8325        YGAINGQGGSTIWLIGILVVFTAISYILGVQFKRMSFLQKLMDGTTQIGIRAVFALIILL
    Newman          YGAINGQGGSTIWLIGILVVFTAISYILGVQFKRMSFLQKLMDGTTQIGIRAVFALIILL
    USA300_FPR3757  YGAINGQGGSTIWLIGILVVFTAISYILGVQFKRMSFLQKLMDGTTQIGIRAVFALIILL
                    ************************************************************

    N315            VALAEGVGAENILGAFLAGVVVSLLNPDEEMVEKLDSFGYGFFIPIFFIMVGVDLNIPSL
    NCTC8325        VALAEGVGAENILGAFLAGVVVSLLNPDEEMVEKLDSFGYGFFIPIFFIMVGVDLNIPSL
    Newman          VALAEGVGAENILGAFLAGVVVSLLNPDEEMVEKLDSFGYGFFIPIFFIMVGVDLNIPSL
    USA300_FPR3757  VALAEGVGAENILGAFLAGVVVSLLNPDEEMVEKLDSFGYGFFIPIFFIMVGVDLNIPSL
                    ************************************************************

    N315            IKEPKLLIIIPILIVAFIISKLIPVMFIRRWFDMKTTIASAFLLTSTLSLVIAAAKISER
    NCTC8325        IKEPKLLIIIPILIVAFIISKLIPVMFIRRWFDMKTTIASAFLLTSTLSLVIAAAKISER
    Newman          IKEPKLLIIIPILIVAFIISKLIPVMFIRRWFDMKTTIASAFLLTSTLSLVIAAAKISER
    USA300_FPR3757  IKEPKLLIIIPILIVAFIISKLIPVMFIRRWFDMKTTIASAFLLTSTLSLVIAAAKISER
                    ************************************************************

    N315            LNAISAETSGILILSAVITCVFVPIIFKKLFPVPDEFNRKIEVSLIGKNQLTIPIAQNLT
    NCTC8325        LNAISAETSGILILSAVITCVFVPIIFKKLFPVPDEFNRKIEVSLIGKNQLTIPIAQNLT
    Newman          LNAISAETSGILILSAVITCVFVPIIFKKLFPVPDEFNRKIEVSLIGKNQLTIPIAQNLT
    USA300_FPR3757  LNAISAETSGILILSAVITCVFVPIIFKKLFPVPDEFNRKIEVSLIGKNQLTIPIAQNLT
                    ************************************************************

    N315            SQLYDVTLYYRKDLSDRRQLSDDITMIEIADYEQDVLERLGLFDRDIVVCATNDDDINRK
    NCTC8325        SQLYDVTLYYRKDLSDRRQLSDDITMIEIADYEQDVLERLGLFDRDIVVCATNDDDINRK
    Newman          SQLYDVTLYYRKDLSDRRQLSDDITMIEIADYEQDVLERLGLFDRDIVVCATNDDDINRK
    USA300_FPR3757  SQLYDVTLYYRKDLSDRRQLSDDITMIEIADYEQDVLERLGLFDRDIVVCATNDDDINRK
                    ************************************************************

    N315            VAKLAKAHQVERVICRLESTTDDTELVDSGIEIFSSYLSNKILLKGLIETPNMLNLLSNV
    NCTC8325        VAKLAKAHQVERVICRLESTTDDTELVDSGIEIFSSYLSNKILLKGLIETPNMLNLLSNV
    Newman          VAKLAKAHQVERVICRLESTTDDTELVDSGIEIFSSYLSNKILLKGLIETPNMLNLLSNV
    USA300_FPR3757  VAKLAKAHQVERVICRLESTTDDTELVDSGIEIFSSYLSNKILLKGLIETPNMLNLLSNV
                    ************************************************************

    N315            ETSLYEIQMLNYKYENIQLRNFPFGGDIIFVRIIRNNESIVPHGDTQLRYGDRLIVTGAK
    NCTC8325        ETSLYEIQMLNYKYENIQLRNFPFGGDIIFVRIIRNNESIVPHGDTQLRYGDRLIVTGAK
    Newman          ETSLYEIQMLNYKYENIQLRNFPFGGDIIFVRIIRNNESIVPHGDTQLRYGDRLIVTGAK
    USA300_FPR3757  ETSLYEIQMLNYKYENIQLRNFPFGGDIIFVRIIRNNESIVPHGDTQLRYGDRLIVTGAK
                    ************************************************************

    N315            EYVDELKQELEFYF
    NCTC8325        EYVDELKQELEFYF
    Newman          EYVDELKQELEFYF
    USA300_FPR3757  EYVDELKQELEFYF
                    **************