From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003184000
  • symbol?: fabI
  • description?: enoyl-ACP reductase

      descriptions from strain specific annotations:

    • enoyl-ACP reductase
    • enoyl-(acyl carrier protein) reductase
    • Enoyl-(acyl-carrier-protein) reductase (NADH)
    • enoyl-acyl carrier protein (ACP) reductase
    • enoyl-acyl-carrier-protein reductase, FabI
    • enoyl-[acyl-carrier-protein] reductase [NADPH] FabI
    • Enoyl- reductase
    • trans-2-enoyl-ACP reductase
    • enoyl-[acyl-carrier-protein] reductase [NADH] (nadh-dependent enoyl-acp reductase)
    • enoyl-[acyl-carrier protein] reductase (NADPH)
    • Enoyl acyl carrier protein reductase NADH
  • strand?: +
  • coordinates?: 3575257..3576027
  • synteny block?: BlockID0022710
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1016 (fabI)
    N315:
    SA0869 (fabI)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0965 (fabI)
    08BA02176:
    C248_1034 (fabI)
    11819-97:
    MS7_0966 (fabI)
    71193:
    ST398NM01_1006
    ECT-R 2:
    ECTR2_865
    ED133:
    SAOV_0956
    ED98:
    SAAV_0973 (fabI)
    HO 5096 0412:
    SAEMRSA15_08410 (fabI)
    JH1:
    SaurJH1_1028
    JH9:
    SaurJH9_1009
    JKD6008:
    SAA6008_00965 (fabI)
    JKD6159:
    SAA6159_00867 (fabI)
    LGA251:
    SARLGA251_09260 (fabI)
    M013:
    M013TW_0933
    MRSA252:
    SAR0978 (fabI)
    MSHR1132:
    SAMSHR1132_08580
    MSSA476:
    SAS0880
    Mu3:
    SAHV_1005 (fabI)
    Mu50:
    SAV1011 (fabI)
    MW2:
    MW0892 (fabI)
    RF122:
    SAB0877 (fabI)
    ST398:
    SAPIG1006
    T0131:
    TCH60:
    HMPREF0772_12226 (fabI)
    TW20:
    SATW20_10080 (fabI)
    USA300_TCH1516:
    USA300HOU_0969 (fabI)
    VC40:
    SAVC_04220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
    N315            MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
    NCTC8325        MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
    Newman          MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
    USA300_FPR3757  MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
                    ************************************************************

    COL             HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
    N315            HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
    NCTC8325        HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
    Newman          HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
    USA300_FPR3757  HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
                    ************************************************************

    COL             SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
    N315            SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
    NCTC8325        SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
    Newman          SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
    USA300_FPR3757  SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
                    ************************************************************

    COL             DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
    N315            DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
    NCTC8325        DNIRVNAISASPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
    Newman          DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
    USA300_FPR3757  DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
                    **********.*************************************************

    COL             VTGENIHVDSGFHAIK
    N315            VTGENIHVDSGFHAIK
    NCTC8325        VTGENIHVDSGFHAIK
    Newman          VTGENIHVDSGFHAIK
    USA300_FPR3757  VTGENIHVDSGFHAIK
                    ****************