From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003188000
  • symbol?:
  • description?: Acetyl esterase

      descriptions from strain specific annotations:

    • Acetyl esterase
    • esterase family protein
    • Enterochelin esterase-like enzyme
    • putative acetyl esterase YjcH
  • strand?: +
  • coordinates?: 3579741..3580499
  • synteny block?: BlockID0022750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0968
    08BA02176:
    C248_1038
    11819-97:
    MS7_0969
    71193:
    ST398NM01_1009
    ECT-R 2:
    ECTR2_868
    ED133:
    SAOV_0959
    ED98:
    SAAV_0976
    HO 5096 0412:
    SAEMRSA15_08440
    JH1:
    SaurJH1_1031
    JH9:
    SaurJH9_1012
    JKD6008:
    SAA6008_00968 (fes)
    JKD6159:
    SAA6159_00870
    LGA251:
    SARLGA251_09290
    M013:
    M013TW_0936
    MRSA252:
    SAR0981
    MSHR1132:
    SAMSHR1132_08610
    MSSA476:
    SAS0883
    Mu3:
    SAHV_1008
    Mu50:
    SAV1014
    MW2:
    MW0895
    RF122:
    SAB0880
    ST398:
    SAPIG1009
    T0131:
    SAT0131_01048 (luxS)
    TCH60:
    HMPREF0772_12222
    TW20:
    SATW20_10110
    USA300_TCH1516:
    USA300HOU_0972
    VC40:
    SAVC_04235

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEFKTGKINKHVLYSNILNRDVTLSIYLPESYNQLVKYNVILCFDGLDFLRFGRIQRTY
    N315            MSEFKTGKINKHVLYSNILNRDVTISIYLPESYNQLVKYNVILCFDGLDFLRFGRIQRTY
    NCTC8325        MSEFKTGKINKHVLYSNILNRDVTLSIYLPESYNQLVKYNVILCFDGLDFLRFGRIQRTY
    Newman          MSEFKTGKINKHVLYSNILNRDVTLSIYLPESYNQLVKYNVILCFDGLDFLRFGRIQRTY
    USA300_FPR3757  MSEFKTGKINKHVLYSNILNRDVTLSIYLPESYNQLVKYNVILCFDGLDFLRFGRIQRTY
                    ************************:***********************************

    COL             ESLIKEARIDDAIIVGFHYEDVDKRREEFHPQGSRSHLTIQSVGKEILPFIDSTFSTLKV
    N315            ESLIKEARIDDAIIVGFHYEDVDKRREEFHPQGSRSHLTIQSVGKEILPFIDSTFSTLKV
    NCTC8325        ESLIKEARIDDAIIVGFHYEDVDKRREEFHPQGSRSHLTIQSVGKEILPFIDSTFSTLKV
    Newman          ESLIKEARIDDAIIVGFHYEDVDKRREEFHPQGSRSHLTIQSVGKEILPFIDSTFSTLKV
    USA300_FPR3757  ESLIKEARIDDAIIVGFHYEDVDKRREEFHPQGSRSHLTIQSVGKEILPFIDSTFSTLKV
                    ************************************************************

    COL             GNARLLVGDSLAGSIALLTALTYPTIFSRVAMLSPHSDEKVLDKLNQCANKEQLTIWHVI
    N315            GNARLLVGDSLAGSIALLTALTYPTIFSRVAMLSPHSDDKVLDKLNQCANKEQLTIWHVI
    NCTC8325        GNARLLVGDSLAGSIALLTALTYPTIFSRVAMLSPHSDEKVLDKLNQCANKEQLTIWHVI
    Newman          GNARLLVGDSLAGSIALLTALTYPTIFSRVAMLSPHSDEKVLDKLNQCANKEQLTIWHVI
    USA300_FPR3757  GNARLLVGDSLAGSIALLTALTYPTIFSRVAMLSPHSDEKVLDKLNQCANKEQLTIWHVI
                    **************************************:*********************

    COL             GLDEKDFTLPTNGKRADFLTPNRELAEQIKKYNITYYYDEFDGGHQWKDWKPLLSDILLY
    N315            GLDEKDFTLPTNGKRADFLTPNRELAEQIKKYNITYYYDEFEGGHQWKDWKPLLSDILLY
    NCTC8325        GLDEKDFTLPTNGKRADFLTPNRELAEQIKKYNITYYYDEFDGGHQWKDWKPLLSDILLY
    Newman          GLDEKDFTLPTNGKRADFLTPNRELAEQIKKYNITYYYDEFDGGHQWKDWKPLLSDILLY
    USA300_FPR3757  GLDEKDFTLPTNGKRADFLTPNRELAEQIKKYNITYYYDEFDGGHQWKDWKPLLSDILLY
                    *****************************************:******************

    COL             FLSKNTDDQLYE
    N315            FLRKNTDDQHYE
    NCTC8325        FLSKNTDDQLYE
    Newman          FLSKNTDDQLYE
    USA300_FPR3757  FLSKNTDDQLYE
                    ** ****** **