From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003212000
  • symbol?:
  • description?: IDEAL domain protein

      descriptions from strain specific annotations:

    • IDEAL domain protein
    • ideal domain family
  • strand?: +
  • coordinates?: 3599781..3600008
  • synteny block?: BlockID0022980
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0980
    08BA02176:
    C248_1051
    11819-97:
    MS7_0984
    71193:
    ST398NM01_1024
    ECT-R 2:
    ECTR2_883
    ED133:
    SAOV_0972
    ED98:
    SAAV_0991
    HO 5096 0412:
    SAEMRSA15_08560
    JH1:
    SaurJH1_1107
    JH9:
    SaurJH9_1085
    JKD6008:
    SAA6008_00981
    JKD6159:
    SAA6159_00882
    LGA251:
    SARLGA251_09410
    M013:
    M013TW_0955
    MRSA252:
    SAR0996
    MSHR1132:
    SAMSHR1132_08730
    MSSA476:
    SAS0959
    Mu3:
    SAHV_1020
    Mu50:
    SAV1027
    MW2:
    MW0907
    RF122:
    SAB0892
    ST398:
    SAPIG1024
    T0131:
    SAT0131_01061
    TCH60:
    HMPREF0772_12208
    TW20:
    SATW20_10230
    USA300_TCH1516:
    VC40:
    SAVC_04295

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYNTNVKHTTLEAFVTTVNDLGIELIINEALREVRKRQLIELIDDALVNKDEAAFNQYT
    N315            MKYNTNVKHTTLEAFVTTVNDLGIELIINEALREVRKRQLIELIDDALVNKDEAAFNQYT
    NCTC8325        MKYNTNVKHTTLEAFVTTVNDLGIELIINEALREVRKRQLIELIDDALVNKDEAAFNQYT
    Newman          MKYNTNVKHTTLEAFVTTVNDLGIELIINEALREVRKRQLIELIDDALVNKDEAAFNQYT
    USA300_FPR3757  MKYNTNVKHTTLEAFVTTVNDLGIELIINEALREVRKRQLIELIDDALVNKDEAAFNQYT
                    ************************************************************

    COL             AEYKNLEAFLGE--
    N315            AEYKNLEAFLGE--
    NCTC8325        AEYKNLEAFLGE--
    Newman          AEYKNLEAFLGEIH
    USA300_FPR3757  AEYKNLEAFLGE--
                    ************