From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003239000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3617986..3618102
  • synteny block?: BlockID0023230
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0993
    08BA02176:
    C248_1063
    11819-97:
    MS7_0996
    71193:
    ECT-R 2:
    ECTR2_894
    ED133:
    SAOV_0984c
    ED98:
    SAAV_1002
    HO 5096 0412:
    SAEMRSA15_08700
    JH1:
    SaurJH1_1120
    JH9:
    JKD6008:
    SAA6008_00993
    JKD6159:
    SAA6159_00895
    LGA251:
    SARLGA251_09530
    M013:
    M013TW_0968
    MRSA252:
    SAR1012
    MSHR1132:
    SAMSHR1132_08860
    MSSA476:
    SAS0974
    Mu3:
    Mu50:
    MW2:
    MW0922
    RF122:
    ST398:
    SAPIG1036
    T0131:
    SAT0131_01073
    TCH60:
    TW20:
    SATW20_10350
    USA300_TCH1516:
    USA300HOU_0986
    VC40:
    SAVC_04360

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRYVTMRQFIKRTVKTILVGYVIKFIRNKLSGKSSHPTDNKHN
    NCTC8325        MRYVTMRQFIKRTVKTILVGYVIKFIRNKLSGKSSHPTDNKHN
                    *******************************************