From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003246000
  • symbol?: menD
  • description?: 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylate synthase

      descriptions from strain specific annotations:

    • 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylate synthase
    • 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
    • 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase
    • menaquinone biosynthesis protein
    • 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase
    • putative menaquinone biosynthesis bifunctionalprotein
    • 2-oxoglutarate synthase subunit, 2-oxoacid-ferredoxin oxidoreductase subunit B
    • 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase
    • menaquinone biosynthesis bifunctional protein
  • strand?: +
  • coordinates?: 3621636..3623309
  • synteny block?: BlockID0023300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1052 (menD)
    N315:
    SA0896 (menD)
    NCTC8325:
    Newman:
    NWMN_0913 (memD)
    USA300_FPR3757:
    04-02981:
    SA2981_0998 (menD)
    08BA02176:
    C248_1068 (menD)
    11819-97:
    MS7_1001 (menD)
    71193:
    ST398NM01_1041
    ECT-R 2:
    ECTR2_899 (menD)
    ED133:
    SAOV_0989
    ED98:
    SAAV_1007 (menD)
    HO 5096 0412:
    SAEMRSA15_08750
    JH1:
    SaurJH1_1125
    JH9:
    SaurJH9_1102
    JKD6008:
    SAA6008_00998 (menD)
    JKD6159:
    SAA6159_00900 (menD)
    LGA251:
    SARLGA251_09580
    M013:
    M013TW_0973
    MRSA252:
    SAR1017
    MSHR1132:
    SAMSHR1132_08920
    MSSA476:
    SAS0979
    Mu3:
    SAHV_1036 (menD)
    Mu50:
    SAV1043 (menD)
    MW2:
    MW0927 (menD)
    RF122:
    SAB0910
    ST398:
    SAPIG1041 (menD)
    T0131:
    SAT0131_01078
    TCH60:
    HMPREF0772_12191 (menD)
    TW20:
    SATW20_10400
    USA300_TCH1516:
    USA300HOU_0991 (menD)
    VC40:
    SAVC_04385

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHPNIKTWIHPDERSAA
    N315            MGNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHPNIKTWIHPDERSAA
    NCTC8325        MGNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHPNIKTWIHPDERSAA
    Newman          MGNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHPNIKTWIHPDERSAA
    USA300_FPR3757  MGNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHPNIKTWIHPDERSAA
                    ************************************************************

    COL             FFAVGLIKGSERPVAILCTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQA
    N315            FFAVGLIKGSERPVAILCTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQA
    NCTC8325        FFAVGLIKGSERPVAILCTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQA
    Newman          FFAVGLIKGSERPVAILCTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQA
    USA300_FPR3757  FFAVGLIKGSERPVAILCTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQA
                    ************************************************************

    COL             INQVNMFNNYVSYEFDMPIADDSKETIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLT
    N315            INQVNMFNNYVSYEFDMPIADDSKETINAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLT
    NCTC8325        INQVNMFNNYVSYEFDMPIADDSKETIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLT
    Newman          INQVNMFNNYVSYEFDMPIADDSKETIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLT
    USA300_FPR3757  INQVNMFNNYVSYEFDMPIADDSKETIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLT
                    ***************************:********************************

    COL             PDLNATELLTSEMKILPHYQKSIDASALRHILNKKKGLIIVGDMQHQEVDQILTYSTIYD
    N315            PDLNATELLTSEMKILPHYQKSIDASALRHILNKKKGLIIVGDMQHQEVDQILTYSTIYD
    NCTC8325        PDLNATELLTSEMKILPHYQKSIDASALRHILNKKKGLIIVGDMQHQEVDQILTYSTIYD
    Newman          PDLNATELLTSEMKILPHYQKSIDASALRHILNKKKGLIIVGDMQHQEVDQILTYSTIYD
    USA300_FPR3757  PDLNATELLTSEMKILPHYQKSIDASALRHILNKKKGLIIVGDMQHQEVDQILTYSTIYD
                    ************************************************************

    COL             LPILADPLSHLRKFDHPNVICTYDLLFRSGLDLNVDFVIRVGKPVISKKLNQWLKKTDAF
    N315            LPILADPLSHLRKFDHPNVICTYDLLFRSGLDLNVDFVIRVGKPVISKKLNQWLKKTDAF
    NCTC8325        LPILADPLSHLRKFDHPNVICTYDLLFRSGLDLNVDFVIRVGKPVISKKLNQWLKKTDAF
    Newman          LPILADPLSHLRKFDHPNVICTYDLLFRSGLDLNVDFVIRVGKPVISKKLNQWLKKTDAF
    USA300_FPR3757  LPILADPLSHLRKFDHPNVICTYDLLFRSGLDLNVDFVIRVGKPVISKKLNQWLKKTDAF
                    ************************************************************

    COL             QILVQNNDKIDVFPIAPDISYEISANDFFRSLMEDTTVNRVSWLEKWQCLEKKGRKEIKC
    N315            QILVQNNDKIDVFPIAPDISYEISANDFFRSLMEDTTINRVSWLEKWQCLEKKGRKEIKC
    NCTC8325        QILVQNNDKIDVFPIAPDISYEISANDFFRSLMEDTTVNRVSWLEKWQCLEKKGRKEIKC
    Newman          QILVQNNDKIDVFPIAPDISYEISANDFFRSLMEDTTVNRVSWLEKWQCLEKKGRKEIKC
    USA300_FPR3757  QILVQNNDKIDVFPIAPDISYEISANDFFRSLMEDTTVNRVSWLEKWQCLEKKGRKEIKC
                    *************************************:**********************

    COL             YLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIV
    N315            YLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIV
    NCTC8325        YLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIV
    Newman          YLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIV
    USA300_FPR3757  YLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIV
                    ************************************************************

    COL             STALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESA
    N315            STALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESA
    NCTC8325        STALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESA
    Newman          STALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESA
    USA300_FPR3757  STALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESA
                    ************************************************************

    COL             TDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNFK
    N315            TDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNFK
    NCTC8325        TDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNFK
    Newman          TDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNFK
    USA300_FPR3757  TDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNFK
                    ************************************************************

    COL             QHQILYQKLSEMIHDTL
    N315            QHQILYQKLSEMIHDTL
    NCTC8325        QHQILYQKLSEMIHDTL
    Newman          QHQILYQKLSEMIHDTL
    USA300_FPR3757  QHQILYQKLSEMIHDTL
                    *****************