From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003258000
  • symbol?:
  • description?: ATL autolysin transcription regulator

      descriptions from strain specific annotations:

    • ATL autolysin transcription regulator
    • MarR family transcriptional regulator
    • Putative ATL autolysin transcription regulator
    • marR family protein
    • ATL autolysin transcriptional regulator
    • MarR family regulatory protein
    • transcriptional regulator, MarR family
  • strand?: +
  • coordinates?: 3632489..3632908
  • synteny block?: BlockID0023420
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1006
    08BA02176:
    C248_1077
    11819-97:
    MS7_1009
    71193:
    ST398NM01_1049
    ECT-R 2:
    ECTR2_907
    ED133:
    SAOV_0998
    ED98:
    SAAV_1016
    HO 5096 0412:
    SAEMRSA15_08830
    JH1:
    SaurJH1_1133
    JH9:
    SaurJH9_1110
    JKD6008:
    SAA6008_01006
    JKD6159:
    SAA6159_00908
    LGA251:
    SARLGA251_09660
    M013:
    M013TW_0983
    MRSA252:
    SAR1025
    MSHR1132:
    SAMSHR1132_09000
    MSSA476:
    SAS0987
    Mu3:
    SAHV_1044
    Mu50:
    SAV1051
    MW2:
    MW0935
    RF122:
    ST398:
    SAPIG1049
    T0131:
    SAT0131_01086 (fmtB)
    TCH60:
    HMPREF0772_12182
    TW20:
    SATW20_10480
    USA300_TCH1516:
    VC40:
    SAVC_04425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
    N315            MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
    NCTC8325        MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
    Newman          MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
    USA300_FPR3757  MYKQLEKLITLTNNDLNLVNRRFGQRTDIKSEQLELLRILFNYDRLSQYDLTMKISREQS
                    *****************************.******************************

    COL             IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
    N315            IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
    NCTC8325        IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
    Newman          IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
    USA300_FPR3757  IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
                    ************************************************************

    COL             ELDNLNQLLDKLNQRRISL
    N315            ELDNLNQLLDKLNQRRISL
    NCTC8325        ELDNLNQLLDKLNQRRISL
    Newman          ELDNLNQLLDKLNQRRISL
    USA300_FPR3757  ELDNLNQLLDKLNQRRISL
                    *******************