From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003261000
  • symbol?:
  • description?: GNAT family N-acetyltransferase

      descriptions from strain specific annotations:

    • GNAT family N-acetyltransferase
    • acetyltransferase
    • acetyltransferase, GNAT family protein
    • acetyltransferase (GNAT) family protein
    • acetyltransferase family protein
    • GNAT family acetyltransferase
    • N-acetyltransferase GCN5
  • strand?: -
  • coordinates?: 3637366..3637803
  • synteny block?: BlockID0023450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1008
    08BA02176:
    C248_1079
    11819-97:
    MS7_1011
    71193:
    ST398NM01_1051
    ECT-R 2:
    ECTR2_909
    ED133:
    SAOV_1000c
    ED98:
    SAAV_1018
    HO 5096 0412:
    SAEMRSA15_08850
    JH1:
    SaurJH1_1136
    JH9:
    SaurJH9_1113
    JKD6008:
    SAA6008_01008
    JKD6159:
    SAA6159_00910
    LGA251:
    SARLGA251_09680
    M013:
    M013TW_0985
    MRSA252:
    SAR1027
    MSHR1132:
    SAMSHR1132_09020
    MSSA476:
    SAS0989
    Mu3:
    SAHV_1046
    Mu50:
    SAV1054
    MW2:
    MW0937
    RF122:
    SAB0920c
    ST398:
    SAPIG1051
    T0131:
    SAT0131_01088
    TCH60:
    HMPREF0772_12180
    TW20:
    SATW20_10500
    USA300_TCH1516:
    USA300HOU_0998
    VC40:
    SAVC_04435

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRP
    N315            MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRP
    NCTC8325        MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRP
    Newman          MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRP
    USA300_FPR3757  MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRP
                    ************************************************************

    COL             INETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFK
    N315            INETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFK
    NCTC8325        INETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFK
    Newman          INETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFK
    USA300_FPR3757  INETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFK
                    ************************************************************

    COL             MRGNIFLEEGIEHIEMTKKLTSLN
    N315            MRGNIFLEEGIEHIEMTKKLTSLN
    NCTC8325        MRGNIFLEEGIEHIEMTKKLTSLN
    Newman          MRGNIFLEEGIEHIEMTKKLTSLN
    USA300_FPR3757  MRGNIFLEEGIEHIEMTKKLTSLN
                    ************************