From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003267000
  • symbol?: qoxD
  • description?: quinol oxidase polypeptide IV QoxD

      descriptions from strain specific annotations:

    • quinol oxidase polypeptide IV QoxD
    • quinol oxidase subunit IV
    • quinol oxidase, subunit IV
    • cytochrome aa3 quinol oxidase, subunit IV
    • cytochrome aa3 quinol oxidase subunit IV
    • cytochrome c oxidase subunit IV
    • putative quinol oxidase polypeptide IV QoxD
    • quinol oxidase subunit 4
    • cytochrome c oxidase polypeptide IV
  • strand?: -
  • coordinates?: 3645003..3645281
  • synteny block?: BlockID0023510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1067 (qoxD)
    N315:
    NCTC8325:
    Newman:
    NWMN_0927 (qoxD)
    USA300_FPR3757:
    04-02981:
    SA2981_1012 (qoxD)
    08BA02176:
    C248_1083 (qoxD)
    11819-97:
    MS7_1015 (qoxD)
    71193:
    ST398NM01_1055
    ECT-R 2:
    ECTR2_913 (qoxD)
    ED133:
    SAOV_1004c
    ED98:
    SAAV_1022 (qoxD)
    HO 5096 0412:
    SAEMRSA15_08890 (qoxD)
    JH1:
    SaurJH1_1140
    JH9:
    SaurJH9_1117
    JKD6008:
    SAA6008_01013 (qoxD)
    JKD6159:
    SAA6159_00914 (qoxD)
    LGA251:
    SARLGA251_09720 (qoxD)
    M013:
    M013TW_0989
    MRSA252:
    SAR1031 (qoxD)
    MSHR1132:
    SAMSHR1132_09060
    MSSA476:
    SAS0993
    Mu3:
    SAHV_1050
    Mu50:
    SAV1058
    MW2:
    MW0941
    RF122:
    SAB0924c (qoxD)
    ST398:
    SAPIG1055 (qoxD)
    T0131:
    SAT0131_01093
    TCH60:
    HMPREF0772_12176 (qoxD)
    TW20:
    SATW20_10540 (qoxD)
    USA300_TCH1516:
    USA300HOU_1002 (qoxD)
    VC40:
    SAVC_04455

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG
    N315            MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG
    NCTC8325        ----MKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG
    Newman          MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG
    USA300_FPR3757  ----MKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG
                        ********************************************************

    COL             KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
    N315            KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
    NCTC8325        KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
    Newman          KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
    USA300_FPR3757  KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
                    ************************************