Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003269000
  • symbol?: qoxB
  • description?: quinol oxidase polypeptide I QoxB

      descriptions from strain specific annotations:

    • quinol oxidase polypeptide I QoxB
    • cytochrome aa3 quinol oxidase subunit I
    • quinol oxidase, subunit I
    • putative quinol oxidase polypeptide I
    • Cytochrome aa3 quinol oxidase, subunit I
    • quinol oxidase subunit 1
    • quinol oxidase subunit II
    • cytochrome c oxidase polypeptide I
  • strand?: -
  • coordinates?: 3645885..3647873
  • synteny block?: BlockID0023530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1069 (qoxA)
    N315:
    SA0912 (qoxB)
    NCTC8325:
    Newman:
    NWMN_0929 (qoxB)
    USA300_FPR3757:
    04-02981:
    SA2981_1014 (qoxB)
    08BA02176:
    C248_1085 (qoxB)
    11819-97:
    MS7_1017 (qoxB)
    71193:
    ST398NM01_1057
    ECT-R 2:
    ECTR2_915 (qoxB)
    ED133:
    SAOV_1006c
    ED98:
    SAAV_1024 (qoxA)
    HO 5096 0412:
    SAEMRSA15_08910 (qoxB)
    JH1:
    SaurJH1_1142
    JH9:
    SaurJH9_1119
    JKD6008:
    SAA6008_01015 (qoxB)
    JKD6159:
    SAA6159_00916 (qoxB)
    LGA251:
    SARLGA251_09740 (qoxB)
    M013:
    M013TW_0991
    MRSA252:
    SAR1033 (qoxB)
    MSHR1132:
    SAMSHR1132_09080
    MSSA476:
    SAS0995
    Mu3:
    SAHV_1052 (qoxB)
    Mu50:
    SAV1060 (qoxB)
    MW2:
    MW0943 (qoxB)
    RF122:
    SAB0926c (qoxB)
    ST398:
    SAPIG1057 (qoxB)
    T0131:
    SAT0131_01095
    TCH60:
    HMPREF0772_12174 (qoxB)
    TW20:
    SATW20_10560 (qoxB)
    USA300_TCH1516:
    USA300HOU_1004 (qoxB)
    VC40:
    SAVC_04465

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNFPWDQLLVKGNWMITMAQIGAPFLVIGLIAVITYFKLWKYLYKEWFTSVDHKKIGVMY
    N315            MNFPWDQLLVKGNWMITMAQIGAPFLVIGLIAVITYFKLWKYLYKEWFTSVDHKKIGIMY
    NCTC8325        MNFPWDQLLVKGNWMITMAQIGAPFLVIGLIAVITYFKLWKYLYKEWFTSVDHKKIGIMY
    Newman          MNFPWDQLLVKGNWMITMAQIGAPFLVIGLIAVITYFKLWKYLYKEWFTSVDHKKIGIMY
    USA300_FPR3757  MNFPWDQLLVKGNWMITMAQIGAPFLVIGLIAVITYFKLWKYLYKEWFTSVDHKKIGIMY
                    *********************************************************:**

    COL             LICAVLMFVRGGIDALLIRAQLTVPDNKFLESNHYNEIFSTHGVIMIIFMAMPFIFGLWN
    N315            LICAVLMFVRGGIDALLIRAQLTVPDNKFLESNHYNEIFSTHGVIMIIFMAMPFIFGLWN
    NCTC8325        LICAVLMFVRGGIDALLIRAQLTVPDNKFLESNHYNEIFSTHGVIMIIFMAMPFIFGLWN
    Newman          LICAVLMFVRGGIDALLIRAQLTVPDNKFLESNHYNEIFSTHGVIMIIFMAMPFIFGLWN
    USA300_FPR3757  LICAVLMFVRGGIDALLIRAQLTVPDNKFLESNHYNEIFSTHGVIMIIFMAMPFIFGLWN
                    ************************************************************

    COL             IVVPLQIGARDVAFPVLNNVSFWLFFAGMILFNLSFIIGGSPAAGWTNYAPLAGEFSPGP
    N315            IVVPLQIGARDVAFPVLNNVSFWLFFAGMILFNLSFIIGGSPAAGWTNYAPLAGEFSPGP
    NCTC8325        IVVPLQIGARDVAFPVLNNVSFWLFFAGMILFNLSFIIGGSPAAGWTNYAPLAGEFSPGP
    Newman          IVVPLQIGARDVAFPVLNNVSFWLFFAGMILFNLSFIIGGSPAAGWTNYAPLAGEFSPGP
    USA300_FPR3757  IVVPLQIGARDVAFPVLNNVSFWLFFAGMILFNLSFIIGGSPAAGWTNYAPLAGEFSPGP
                    ************************************************************

    COL             GVNYYLIAIQISGLGTLATGINFFVTILRCKTPTMKFMQMPMFTVTTFITTLIVILAFPP
    N315            GVNYYLIAIQISGLGTLATGINFFVTILRCKTPTMKFMQMPMFTVTTFITTLIVILAFPP
    NCTC8325        GVNYYLIAIQISGLGTLATGINFFVTILRCKTPTMKFMQMPMFTVTTFITTLIVILAFPP
    Newman          GVNYYLIAIQISGLGTLATGINFFVTILRCKTPTMKFMQMPMFTVTTFITTLIVILAFPP
    USA300_FPR3757  GVNYYLIAIQISGLGTLATGINFFVTILRCKTPTMKFMQMPMFTVTTFITTLIVILAFPP
                    ************************************************************

    COL             LTVALALMTTDRIFDTAFFTVAHGGMPMLWANFFWVWGHPEVYIVILPAFGIYSEIIPTF
    N315            LTVALALMTTDRIFDTAFFTVAHGGMPMLWANFFWVWGHPEVYIVILPAFGIYSEIIPTF
    NCTC8325        LTVALALMTTDRIFDTAFFTVAHGGMPMLWANFFWVWGHPEVYIVILPAFGIYSEIIPTF
    Newman          LTVALALMTTDRIFDTAFFTVAHGGMPMLWANFFWVWGHPEVYIVILPAFGIYSEIIPTF
    USA300_FPR3757  LTVALALMTTDRIFDTAFFTVAHGGMPMLWANFFWVWGHPEVYIVILPAFGIYSEIIPTF
                    ************************************************************

    COL             ARKRLFGHQSMVWATAGIAFLSFLVWVHHFFTMGNGALINSFFSISTMLIGIPTGVKLFN
    N315            ARKRLFGHQSMVWATAGIAFLSFLVWVHHFFTMGNGALINSFFSISTMLIGIPTGVKLFN
    NCTC8325        ARKRLFGHQSMVWATAGIAFLSFLVWVHHFFTMGNGALINSFFSISTMLIGIPTGVKLFN
    Newman          ARKRLFGHQSMVWATAGIAFLSFLVWVHHFFTMGNGALINSFFSISTMLIGIPTGVKLFN
    USA300_FPR3757  ARKRLFGHQSMVWATAGIAFLSFLVWVHHFFTMGNGALINSFFSISTMLIGIPTGVKLFN
                    ************************************************************

    COL             WLLTLYKGRITFESPMLFSLAFIPNFLLGGVTGVMLAMASADYQYHNTYFLVAHFHYTLV
    N315            WLLTLYKGRITFESPMLFSLAFIPNFLLGGVTGVMLAMASADYQYHNTYFLVAHFHYTLV
    NCTC8325        WLLTLYKGRITFESPMLFSLAFIPNFLLGGVTGVMLAMASADYQYHNTYFLVAHFHYTLV
    Newman          WLLTLYKGRITFESPMLFSLAFIPNFLLGGVTGVMLAMASADYQYHNTYFLVAHFHYTLV
    USA300_FPR3757  WLLTLYKGRITFESPMLFSLAFIPNFLLGGVTGVMLAMASADYQYHNTYFLVAHFHYTLV
                    ************************************************************

    COL             TGVVFACLAGLIFWYPKMMGYKLNETLNKWCFWFFMIGFNVCFLPQFILGLDGMPRRLYT
    N315            TGVVFACLAGLIFWYPKMMGYKLNETLNKWCFWFFMIGFNVCFLPQFILGLDGMPRRLYT
    NCTC8325        TGVVFACLAGLIFWYPKMMGYKLNETLNKWCFWFFMIGFNVCFLPQFILGLDGMPRRLYT
    Newman          TGVVFACLAGLIFWYPKMMGYKLNETLNKWCFWFFMIGFNVCFLPQFILGLDGMPRRLYT
    USA300_FPR3757  TGVVFACLAGLIFWYPKMMGYKLNETLNKWCFWFFMIGFNVCFLPQFILGLDGMPRRLYT
                    ************************************************************

    COL             YMPSDGWFLLNLISTIGALLMAIGFLFLVVSIVYSHFKSPREATGDNWDGLGRTLEWTTA
    N315            YMPSDGWFLLNLISTIGALLMAIGFLFLVVSIVYSHFKSPREATGDNWDGLGRTLEWTTA
    NCTC8325        YMPSDGWFLLNLISTIGALLMAIGFLFLVVSIVYSHFKSPREATGDNWDGLGRTLEWTTA
    Newman          YMPSDGWFLLNLISTIGALLMAIGFLFLVVSIVYSHFKSPREATGDNWDGLGRTLEWTTA
    USA300_FPR3757  YMPSDGWFLLNLISTIGALLMAIGFLFLVVSIVYSHFKSPREATGDNWDGLGRTLEWTTA
                    ************************************************************

    COL             SAIPPKYNFAITPDWNDYDTFVDMKEHGRHYLDNHNYKDIHMPNNTPVGFWIGIFMTIGG
    N315            SAIPPKYNFAITPDWNDYDTFVDMKEHGRHYLDNHNYKDIHMPNNTPVGFWIGIFMTIGG
    NCTC8325        SAIPPKYNFAITPDWNDYDTFVDMKEHGRHYLDNHNYKDIHMPNNTPVGFWIGIFMTIGG
    Newman          SAIPPKYNFAITPDWNDYDTFVDMKEHGRHYLDNHNYKDIHMPNNTPVGFWIGIFMTIGG
    USA300_FPR3757  SAIPPKYNFAITPDWNDYDTFVDMKEHGRHYLDNHNYKDIHMPNNTPVGFWIGIFMTIGG
                    ************************************************************

    COL             FFLIFETVIPALICLFGIFGTMIYRSFQIDHGYHIPAAEVAETEARLREARIKEREAVSH
    N315            FFLIFETVIPALICLFGIFGTMIYRSFQIDHGYHIPAAEVAETEARLREARIKEREAVSH
    NCTC8325        FFLIFETVIPALICLFGIFGTMIYRSFQIDHGYHIPAAEVAETEARLREARIKEREAVSH
    Newman          FFLIFETVIPALICLFGIFGTMIYRSFQIDHGYHIPAAEVAETEARLREARIKEREAVSH
    USA300_FPR3757  FFLIFETVIPALICLFGIFGTMIYRSFQIDHGYHIPAAEVAETEARLREARIKEREAVSH
                    ************************************************************

    COL             ES
    N315            ES
    NCTC8325        ES
    Newman          ES
    USA300_FPR3757  ES
                    **