From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003273000
  • symbol?:
  • description?: chitinase B

      descriptions from strain specific annotations:

    • chitinase B
    • bacterial Ig-like domain family protein
    • exported protein
    • Ig-like domain (group 3) protein
  • strand?: -
  • coordinates?: 3649825..3650142
  • synteny block?: BlockID0023570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1017
    08BA02176:
    C248_1087
    11819-97:
    MS7_1020
    71193:
    ST398NM01_1060
    ECT-R 2:
    ECTR2_918
    ED133:
    SAOV_1008c
    ED98:
    SAAV_1027
    HO 5096 0412:
    SAEMRSA15_08930
    JH1:
    SaurJH1_1144
    JH9:
    SaurJH9_1122
    JKD6008:
    SAA6008_01018
    JKD6159:
    SAA6159_00918
    LGA251:
    SARLGA251_09760
    M013:
    M013TW_0994
    MRSA252:
    SAR1035
    MSHR1132:
    SAMSHR1132_09100
    MSSA476:
    SAS0997
    Mu3:
    SAHV_1054
    Mu50:
    SAV1062
    MW2:
    MW0945
    RF122:
    SAB0928c
    ST398:
    SAPIG1060
    T0131:
    SAT0131_01098
    TCH60:
    HMPREF0772_12172
    TW20:
    SATW20_10580
    USA300_TCH1516:
    USA300HOU_1007
    VC40:
    SAVC_04475

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKLLQSLSALGVSATLVTPNLNADATTNTTPQIKGANDIVIKKGQDYNLLNGISAFDKE
    N315            MNKLLQSLSALGVSATLVTPNLNADATTNTTPQIKGANDIVIKKGQDYNLLNGISAFDKE
    NCTC8325        MNKLLQSLSALGVSATLVTPNLNADATTNTTPQIKGANDIVIKKGQDYNLLNGISAFDKE
    Newman          MNKLLQSLSALGVSATLVTPNLNADATTNTTPQIKGANDIVIKKGQDYNLLNGISAFDKE
    USA300_FPR3757  MNKLLQSLSALGVSATLVTPNLNADATTNTTPQIKGANDIVIKKGQDYNLLNGISAFDKE
                    ************************************************************

    COL             DGDLTDKIKVDGQIDTSKSGKYQIKYHVTDSDGAIKISTRYIEVK
    N315            DGDLTDKIKVDGQIDTSKSGKYQIKYHVTDSDGAIKISTRYIEVK
    NCTC8325        DGDLTDKIKVDGQIDTSKSGKYQIKYHVTDSDGAIKISTRYIEVK
    Newman          DGDLTDKIKVDGQIDTSKSGKYQIKYHVTDSDGAIKISTRYIEVK
    USA300_FPR3757  DGDLTDKIKVDGQIDTSKSGKYQIKYHVTDSDGAIKISTRYIEVK
                    *********************************************