From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003276000
  • symbol?: folD
  • description?: bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase

      descriptions from strain specific annotations:

    • bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase
    • bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
    • bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, FolD
    • bifunctional methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase
    • bifunctional methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate
    • bifunctional protein FolD
    • methylenetetrahydrofolate dehydrogenase
    • Methylenetetrahydrofolate dehydrogenase (NADP+) / Methenyltetrahydrofolate cyclohydrolase
    • tetrahydrofolate dehydrogenase/cyclohydrolase domain protein
  • strand?: -
  • coordinates?: 3651410..3652270
  • synteny block?: BlockID0023600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1072 (folD)
    N315:
    SA0915 (folD)
    NCTC8325:
    Newman:
    NWMN_0932 (folD)
    USA300_FPR3757:
    04-02981:
    SA2981_1019 (folD)
    08BA02176:
    C248_1088 (folD)
    11819-97:
    MS7_1021
    71193:
    ST398NM01_1061
    ECT-R 2:
    ECTR2_919
    ED133:
    SAOV_1009c
    ED98:
    SAAV_1028 (folD)
    HO 5096 0412:
    SAEMRSA15_08940 (folD)
    JH1:
    SaurJH1_1145
    JH9:
    SaurJH9_1123
    JKD6008:
    SAA6008_01019 (folD)
    JKD6159:
    SAA6159_00919 (folD)
    LGA251:
    SARLGA251_09770 (folD)
    M013:
    M013TW_0995
    MRSA252:
    SAR1037 (folD)
    MSHR1132:
    SAMSHR1132_09110
    MSSA476:
    SAS0999
    Mu3:
    SAHV_1055 (folD)
    Mu50:
    SAV1063 (folD)
    MW2:
    MW0946 (folD)
    RF122:
    SAB0930c (folD)
    ST398:
    SAPIG1061
    T0131:
    SAT0131_01099
    TCH60:
    HMPREF0772_12170 (folD)
    TW20:
    SATW20_10590 (folD)
    USA300_TCH1516:
    USA300HOU_1008 (folD)
    VC40:
    SAVC_04480

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVAKILDGKQIAKDYRQGLQDQVEALKEKGFTPKLSVILVGNDGASQSYVRSKKKAAEKI
    N315            MVAKILDGKQIAKDYRQGLQDQVEALKEKGFTPKLSVILVGNDGASQSYVRSKKKAAEKI
    NCTC8325        MVAKILDGKQIAKDYRQGLQDQVEALKEKGFTPKLSVILVGNDGASQSYVRSKKKAAEKI
    Newman          MVAKILDGKQIAKDYRQGLQDQVEALKEKGFTPKLSVILVGNDGASQSYVRSKKKAAEKI
    USA300_FPR3757  MVAKILDGKQIAKDYRQGLQDQVEALKEKGFTPKLSVILVGNDGASQSYVRSKKKAAEKI
                    ************************************************************

    COL             GMISEIVHLEETATEEEVLNELNRLNNDDSVSGILVQVPLPKQVSEQKILEAINPEKDVD
    N315            GMISEIVHLEETATEEEVLNELNRLNNDDSVSGILVQVPLPKQVSEQKILEAINPEKDVD
    NCTC8325        GMISEIVHLEETATEEEVLNELNRLNNDDSVSGILVQVPLPKQVSEQKILEAINPEKDVD
    Newman          GMISEIVHLEETATEEEVLNELNRLNNDDSVSGILVQVPLPKQVSEQKILEAINPEKDVD
    USA300_FPR3757  GMISEIVHLEETATEEEVLNELNRLNNDDSVSGILVQVPLPKQVSEQKILEAINPEKDVD
                    ************************************************************

    COL             GFHPINIGKLYIDEQTFVPCTPLGIMEILKHADIDLEGKNAVVIGRSHIVGQPVSKLLLQ
    N315            GFHPINIGKLYIDEQTFVPCTPLGIMEILKHADIDLEAKNAVVIGRSHIVGQPVSKLLLQ
    NCTC8325        GFHPINIGKLYIDEQTFVPCTPLGIMEILKHADIDLEGKNAVVIGRSHIVGQPVSKLLLQ
    Newman          GFHPINIGKLYIDEQTFVPCTPLGIMEILKHADIDLEGKNAVVIGRSHIVGQPVSKLLLQ
    USA300_FPR3757  GFHPINIGKLYIDEQTFVPCTPLGIMEILKHADIDLEGKNAVVIGRSHIVGQPVSKLLLQ
                    *************************************.**********************

    COL             KNASVTILHSRSKDMASYLKDADVIVSAVGKPGLVTKDVVKEGAVIIDVGNTPDENGKLK
    N315            KNASVTILHSRSKDMASYLKDADVIVSAVGKPSLVTKDVVKEGAVIIDVGNTPDENGKLK
    NCTC8325        KNASVTILHSRSKDMASYLKDADVIVSAVGKPGLVTKDVVKEGAVIIDVGNTPDENGKLK
    Newman          KNASVTILHSRSKDMASYLKDADVIVSAVGKPGLVTKDVVKEGAVIIDVGNTPDENGKLK
    USA300_FPR3757  KNASVTILHSRSKDMASYLKDADVIVSAVGKPGLVTKDVVKEGAVIIDVGNTPDENGKLK
                    ********************************.***************************

    COL             GDVDYDAVKEIAGAITPVPGGVGPLTITMVLNNTLLAEKMRRGIDS
    N315            GDVDYDAVKEIAGAITPVPGGVGPLTITMVLNNTLLAEKMRRGIDS
    NCTC8325        GDVDYDAVKEIAGAITPVPGGVGPLTITMVLNNTLLAEKMRRGIDS
    Newman          GDVDYDAVKEIAGAITPVPGGVGPLTITMVLNNTLLAEKMRRGIDS
    USA300_FPR3757  GDVDYDAVKEIAGAITPVPGGVGPLTITMVLNNTLLAEKMRRGIDS
                    **********************************************