From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003280000
  • symbol?: purS
  • description?: phosphoribosylformylglycinamidine synthase, PurS protein

      descriptions from strain specific annotations:

    • phosphoribosylformylglycinamidine synthase, PurS protein
    • phosphoribosylformylglycinamidine synthase PurS
    • phosphoribosylformylglycinamidine synthase subunit PurS
    • Phosphoribosylformylglycinamidine synthase, PurS subunit
    • Phosphoribosylformylglycinamidine synthase, purS
    • phosphoribosylformylglycinamidine synthase, purS component
  • strand?: +
  • coordinates?: 3654772..3655035
  • synteny block?: BlockID0023640
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1076 (purS)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1023 (purS)
    08BA02176:
    C248_1092 (purS)
    11819-97:
    MS7_1025 (purS)
    71193:
    ST398NM01_1065
    ECT-R 2:
    ECTR2_923 (purS)
    ED133:
    SAOV_1012
    ED98:
    SAAV_1032 (purS)
    HO 5096 0412:
    SAEMRSA15_08980
    JH1:
    SaurJH1_1149
    JH9:
    SaurJH9_1127
    JKD6008:
    SAA6008_01023 (purS)
    JKD6159:
    SAA6159_00923 (purS)
    LGA251:
    SARLGA251_09810
    M013:
    M013TW_0999
    MRSA252:
    SAR1041
    MSHR1132:
    SAMSHR1132_09150
    MSSA476:
    SAS1003
    Mu3:
    SAHV_1059
    Mu50:
    SAV1067
    MW2:
    MW0950
    RF122:
    SAB0934
    ST398:
    SAPIG1065 (purS)
    T0131:
    SAT0131_01103
    TCH60:
    HMPREF0772_12166 (purS2)
    TW20:
    SATW20_10630
    USA300_TCH1516:
    USA300HOU_1012 (purS)
    VC40:
    SAVC_04500

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIIT
    N315            MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIIT
    NCTC8325        MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIIT
    USA300_FPR3757  MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIIT
                    ************************************************************

    COL             TLSEKLFANTVIEEYSYKVLDDEKENA
    N315            TLSEKLFANTVIEEYSYKVLDDEKENA
    NCTC8325        TLSEKLFANTVIEEYSYKVLDDEKENA
    USA300_FPR3757  TLSEKLFANTVIEEYSYKVLDDEKENA
                    ***************************