From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003291000
  • symbol?: thiW
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter, ATP-binding protein
    • ABC transporter family protein
    • cation ABC transporter
    • cation ATP-binding ABC transporter protein
    • Duplicated ATPase component YkoD of energizingmodule of thiamin-regulated ECF transporter
    • Duplicated ATPase component YkoD of energizing module of thiamin-regulated ECF transporter for HydroxyMethylPyrimidine
    • heme ABC transporter ATP-binding protein CcmA
    • hydroxymethylpyrimidine transport ATP-binding protein
  • strand?: -
  • coordinates?: 3664839..3666059
  • synteny block?: BlockID0023750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1032
    08BA02176:
    C248_1102
    11819-97:
    MS7_1034
    71193:
    ST398NM01_1074
    ECT-R 2:
    ECTR2_932
    ED133:
    SAOV_1021c
    ED98:
    SAAV_1041
    HO 5096 0412:
    SAEMRSA15_09070
    JH1:
    SaurJH1_1158
    JH9:
    SaurJH9_1136
    JKD6008:
    SAA6008_01032 (ykoD)
    JKD6159:
    SAA6159_00932 (ykoD)
    LGA251:
    SARLGA251_09900 (ykoD)
    M013:
    M013TW_1009
    MRSA252:
    SAR1050
    MSHR1132:
    SAMSHR1132_09240
    MSSA476:
    SAS1012
    Mu3:
    SAHV_1068
    Mu50:
    SAV1076
    MW2:
    MW0959
    RF122:
    SAB0943c
    ST398:
    SAPIG1074
    T0131:
    SAT0131_01113
    TCH60:
    HMPREF0772_12157
    TW20:
    SATW20_10720 (ykoD)
    USA300_TCH1516:
    USA300HOU_1020
    VC40:
    SAVC_04545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKVSDLRLKYPSGQRKIFDHLNITIQDKEKVLLLGPSGCGKSTLLNVLSGIVPNLIELP
    N315            MLKVSDLRLKYPNGQRKIFDHLNITIQDKEKVLLLGPSGCGKSTLLNVLSGIVPNLIELP
    NCTC8325        MLKVSDLRLKYPSGQRKIFDHLNITIQDKEKVLLLGPSGCGKSTLLNVLSGIVPNLIELP
    Newman          MLKVSDLRLKYPSGQRKIFDHLNITIQDKEKVLLLGPSGCGKSTLLNVLSGIVPNLIELP
    USA300_FPR3757  MLKVSDLRLKYPSGQRKIFDHLNITIQDKEKVLLLGPSGCGKSTLLNVLSGIVPNLIELP
                    ************.***********************************************

    COL             MKYDELIVDPLSGVIFQDPDSQFCMPKVYEELAFVLENRQLPREDMDALIINALNMVNLN
    N315            MKYDELIVDPLSGVIFQDPDSQFCMPKVYEELAFVLENRQVPREDMDALIINALNMVNLN
    NCTC8325        MKYDELIVDPLSGVIFQDPDSQFCMPKVYEELAFVLENRQLPREDMDALIINALNMVNLN
    Newman          MKYDELIVDPLSGVIFQDPDSQFCMPKVYEELAFVLENRQLPREDMDALIINALNMVNLN
    USA300_FPR3757  MKYDELIVDPLSGVIFQDPDSQFCMPKVYEELAFVLENRQLPREDMDALIINALNMVNLN
                    ****************************************:*******************

    COL             VTPETYIKDLSGGMKQKLAIVETILQQSKTLFLDEPTAMLDVQATEDLWTKLIELWEDQT
    N315            VTPETYIKDLSGGMKQKLAIVETILQQSKTLFLDEPTAMLDVQATEDLWTKLIELWEDQT
    NCTC8325        VTPETYIKDLSGGMKQKLAIVETILQQSKTLFLDEPTAMLDVQATEDLWTKLIELWEDQT
    Newman          VTPETYIKDLSGGMKQKLAIVETILQQSKTLFLDEPTAMLDVQATEDLWTKLIELWEDQT
    USA300_FPR3757  VTPETYIKDLSGGMKQKLAIVETILQQSKTLFLDEPTAMLDVQATEDLWTKLIELWEDQT
                    ************************************************************

    COL             VVIVEHKVKHIWNHVDRVILMDYNGNIIADECPEIILQKYVHLLSEYGVWHPRAWEFAPS
    N315            VVIVEHKVKHIWNHVDRVILMDYNGNIIADECPEIILQKYVHLLSEYGVWHPRAWEFAPS
    NCTC8325        VVIVEHKVKHIWNHVDRVILMDYNGNIIADECPEIILQKYVHLLSEYGVWHPRAWEFAPS
    Newman          VVIVEHKVKHIWNHVDRVILMDYNGNIIADECPEIILQKYVHLLSEYGVWHPRAWEFAPS
    USA300_FPR3757  VVIVEHKVKHIWNHVDRVILMDYNGNIIADECPEIILQKYVHLLSEYGVWHPRAWEFAPS
                    ************************************************************

    COL             RVDFPTTNSHLLQFKNGRIIRGKSTLLSFSDLEIGLGEWITITGANGSGKTTLLESIMQL
    N315            RVDFPTTNSHLLQFKNGRIIRGKSTLLSFSDLEIGLGEWITITGANGSGKTTLLESIMQL
    NCTC8325        RVDFPTTNSHLLQFKNGRIIRGKSTLLSFSDLEIGLGEWITITGANGSGKTTLLESIMQL
    Newman          RVDFPTTNSHLLQFKNGRIIRGKSTLLSFSDLEIGLGEWITITGANGSGKTTLLESIMQL
    USA300_FPR3757  RVDFPTTNSHLLQFKNGRIIRGKSTLLSFSDLEIGLGEWITITGANGSGKTTLLESIMQL
                    ************************************************************

    COL             IKYQGDVYFENQRLTKIKHAAKHMYLVYQNPELQFITNSVYDEINIHFNHLSKDQSDDET
    N315            IKYQGDVYFENQRLTKIKHAAKHMYLVYQNPELQFITNSVYDEINIHFNHLSKDQSDDET
    NCTC8325        IKYQGDVYFENQRLTKIKHAAKHMYLVYQNPELQFITNSVYDEINIHFNHLSKDQSDDET
    Newman          IKYQGDVYFENQRLTKIKHAAKHMYLVYQNPELQFITNSVYDEINIHFNHLSKDQSDDET
    USA300_FPR3757  IKYQGDVYFENQRLTKIKHAAKHMYLVYQNPELQFITNSVYDEINIHFNHLSKDQSDDET
                    ************************************************************

    COL             IQLLKLLDLQNVKDQHPYELSIGQKRRLSVATALSSKADIIFLDEPTFGLDSHNTFQLIK
    N315            IQLLKLLDLQNVKDQHPYELSIGQKRRLSVATALSSKADIIFLDEPTFGLDSHNTFQLIK
    NCTC8325        IQLLKLLDLQNVKDQHPYELSIGQKRRLSVATALSSKADIIFLDEPTFGLDSHNTFQLIK
    Newman          IQLLKLLDLQNVKDQHPYELSIGQKRRLSVATALSSKADIIFLDEPTFGLDSHNTFQLIK
    USA300_FPR3757  IQLLKLLDLQNVKDQHPYELSIGQKRRLSVATALSSKADIIFLDEPTFGLDSHNTFQLIK
                    ************************************************************

    COL             LFQKRINLGQSIVMVTHDDEIIERYPSRRLKISDGALLDCDGDTNV
    N315            LFQKRINLGQSIVMVTHDDEIIERYPSRRLKISDGALLDCDGDTNV
    NCTC8325        LFQKRINLGQSIVMVTHDDEIIERYPSRRLKISDGALLDCDGDTNV
    Newman          LFQKRINLGQSIVMVTHDDEIIERYPSRRLKISDGALLDCDGDTNV
    USA300_FPR3757  LFQKRINLGQSIVMVTHDDEIIERYPSRRLKISDGALLDCDGDTNV
                    **********************************************