From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003292000
  • symbol?: thiV
  • description?: thiamine ABC transporter permease

      descriptions from strain specific annotations:

    • thiamine ABC transporter permease
    • ABC-type cobalt transport system, permease component family protein
    • cobalt ABC transporter permease
    • hydroxymethylpyrimidine transport system permease protein
    • membrane protein
    • Membrane protein-like protein
    • Substrate-specific component YkoE of thiamin-regulated ECF transporter for HydroxyMethylPyrimidine
  • strand?: -
  • coordinates?: 3666255..3666830
  • synteny block?: BlockID0023760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1033
    08BA02176:
    C248_1103
    11819-97:
    MS7_1035
    71193:
    ST398NM01_1075
    ECT-R 2:
    ECTR2_933
    ED133:
    SAOV_1022c
    ED98:
    SAAV_1042
    HO 5096 0412:
    SAEMRSA15_09080
    JH1:
    SaurJH1_1159
    JH9:
    SaurJH9_1137
    JKD6008:
    SAA6008_01033
    JKD6159:
    SAA6159_00933
    LGA251:
    SARLGA251_09910 (ykoE)
    M013:
    M013TW_1010
    MRSA252:
    SAR1051
    MSHR1132:
    SAMSHR1132_09250
    MSSA476:
    SAS1013
    Mu3:
    SAHV_1069
    Mu50:
    SAV1077
    MW2:
    MW0960
    RF122:
    SAB0944c
    ST398:
    SAPIG1075
    T0131:
    SAT0131_01114
    TCH60:
    HMPREF0772_12156
    TW20:
    SATW20_10730 (ykoE)
    USA300_TCH1516:
    USA300HOU_1021
    VC40:
    SAVC_04550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKGLKLSEILVTVLISVVFAVIYNLWWFVYNGVQATGLHLEQLTNGVWFMAAIVCYLII
    N315            MSKGLKLSEILVTVLISVVFAVIYNLWWFVYNGVQATGLHLEQLTNGVWFMAAIVCYLII
    NCTC8325        MSKGLKLSEILVTVLISVVFAVIYNLWWFVYNGVQATGLHLEQLTNGVWFMAAIVCYLII
    Newman          MSKGLKLSEILVTVLISVVFAVIYNLWWFVYNGVQATGLHLEQLTNGVWFMAAIVCYLII
    USA300_FPR3757  MSKGLKLSEILVTVLISVVFAVIYNLWWFVYNGVQATGLHLEQLTNGVWFMAAIVCYLII
                    ************************************************************

    COL             PKPGIALLAEFAAGAGETIIMGRFDIPTIVYAFIQGLACELVFAIFKYQSRSVMVAMLAG
    N315            PKPGIALLAEFAAGAGETIIMGRFDIPTIVYAFIQGLACELVFAIFKYQSRSVMVAMLAG
    NCTC8325        PKPGIALLAEFAAGAGETIIMGRFDIPTIVYAFIQGLACELVFAIFKYQSRSVMVAMLAG
    Newman          PKPGIALLAEFAAGAGETIIMGRFDIPTIVYAFIQGLACELVFAIFKYQSRSVMVAMLAG
    USA300_FPR3757  PKPGIALLAEFAAGAGETIIMGRFDIPTIVYAFIQGLACELVFAIFKYQSRSVMVAMLAG
                    ************************************************************

    COL             FCTAIAAFPIDYFYGYLNEVAGWNLTLFIVFRLISGAVVAGVLSYLLVKALDKTGVTKLF
    N315            FCTAIAAFPIDYFYGYLNEVAGWNLTLFIVFRLISGAVVAGVLSYLLVKALDKTGVTKLF
    NCTC8325        FCTAIAAFPIDYFYGYLNEVAGWNLTLFIVFRLISGAVVAGVLSYLLVKALDKTGVTKLF
    Newman          FCTAIAAFPIDYFYGYLNEVAGWNLTLFIVFRLISGAVVAGVLSYLLVKALDKTGVTKLF
    USA300_FPR3757  FCTAIAAFPIDYFYGYLNEVAGWNLTLFIVFRLISGAVVAGVLSYLLVKALDKTGVTKLF
                    ************************************************************

    COL             RPAAKEDYDNL
    N315            RPAAKEDYDNL
    NCTC8325        RPAAKEDYDNL
    Newman          RPAAKEDYDNL
    USA300_FPR3757  RPAAKEDYDNL
                    ***********