From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003299000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • membrane spanning protein
  • strand?: +
  • coordinates?: 3670015..3671319
  • synteny block?: BlockID0023830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1036
    08BA02176:
    C248_1105
    11819-97:
    MS7_1037
    71193:
    ST398NM01_1077
    ECT-R 2:
    ECTR2_935
    ED133:
    SAOV_1024
    ED98:
    SAAV_1045
    HO 5096 0412:
    SAEMRSA15_09100
    JH1:
    SaurJH1_1161
    JH9:
    SaurJH9_1140
    JKD6008:
    SAA6008_01035
    JKD6159:
    SAA6159_00936
    LGA251:
    SARLGA251_09930
    M013:
    M013TW_1012
    MRSA252:
    SAR1053
    MSHR1132:
    SAMSHR1132_09270
    MSSA476:
    SAS1015
    Mu3:
    SAHV_1072
    Mu50:
    SAV1080
    MW2:
    MW0962
    RF122:
    SAB0945
    ST398:
    SAPIG1077
    T0131:
    SAT0131_01116
    TCH60:
    HMPREF0772_12154
    TW20:
    SATW20_10750
    USA300_TCH1516:
    USA300HOU_1022
    VC40:
    SAVC_04560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFLRKHAEIIFSYLIGIVSLFTGLIILINLPLIKQLNGGKKVDTHVHNVWEFLNAFFSE
    N315            MSFLRKHAEIIFSYLIGIVSLFTGLIILINLPLIKQLNGGKKVDTHVHNVWEFLNAFFSE
    NCTC8325        MSFLRKHAEIIFSYLIGIVSLFTGLIILINLPLIKQLNGGKKVDTHVHNVWEFLNAFFSE
    Newman          MSFLRKHAEIIFSYLIGIVSLFTGLIILINLPLIKQLNGGKKVDTHVHNVWEFLNAFFSE
    USA300_FPR3757  MSFLRKHAEIIFSYLIGIVSLFTGLIILINLPLIKQLNGGKKVDTHVHNVWEFLNAFFSE
                    ************************************************************

    COL             IIKVMSRFIGNFPIVSAIVIIIFGILVMLIGHTLLRTIKYDYDISIFFLVIGIMYFIITL
    N315            IIKVMSRFIGNFPIVSAIVIIIFGILVMLIGHTLLRTIKYDYDISIFFLVIGIMYFIITL
    NCTC8325        IIKVMSRFIGNFPIVSAIVIIIFGILVMLIGHTLLRTIKYDYDISIFFLVIGIMYFIITL
    Newman          IIKVMSRFIGNFPIVSAIVIIIFGILVMLIGHTLLRTIKYDYDISIFFLVIGIMYFIITL
    USA300_FPR3757  IIKVMSRFIGDFPIVSAIVIIIFGILVMLIGHTLLRTIKYDYDISIFFLVIGIMYFIITL
                    **********:*************************************************

    COL             ILMTQVYGFFAVIFIIPFTIHIGYIVYKDELNQENVKNHFMWIIVSYGISYLITQIALYG
    N315            ILMTQVYGFFAVIFIIPFTIHIGYIVYKDELNQENVKNHFMWIIVSYGISYLITQIALYG
    NCTC8325        ILMTQVYGFFAVIFIIPFTIHIGYIVYKDELNQENVKNHFMWIIVSYGISYLITQIALYG
    Newman          ILMTQVYGFFAVIFIIPFTIHIGYIVYKDELNQENVKNHFMWIIVSYGISYLITQIALYG
    USA300_FPR3757  ILMTQVYGFFAVIFIIPFTIHIGYIVYKDELNQENVKNHFMWIIVSYGISYLITQIALYG
                    ************************************************************

    COL             RIDANEIESIDILSVNAFFIIMWLLGQMAIWNFLFLRRALPLTKQELGEEEPELSRTSKG
    N315            RIDANEIESIDILSVNAFFIIMWLLGQMAIWNFLFLRRALPLTKQELGEEEPELSRTSKG
    NCTC8325        RIDANEIESIDILSVNAFFIIMWLLGQMAIWNFLFLRRALPLTKQELGEEEPELSRTSKG
    Newman          RIDANEIESIDILSVNAFFIIMWLLGQMAIWNFLFLRRALPLTKQELGEEEPELSRTSKG
    USA300_FPR3757  RIDANEIESIDILSVNAFFIIMWLLGQMAIWNFLFLRRALPLTKQELGEEEPELSRTSKG
                    ************************************************************

    COL             NVTNQTKIHLKQLQDKTTEYARKTRRSVDLDKIRAKRDKFKKKVNDIIDIQEDDIPDWMR
    N315            NVTNQTKIHLKQLQDKTTEYARKTRRSVDLDKIRAKRDKFKKKVNDIIDIQEDDIPDWMR
    NCTC8325        NVTNQTKIHLKQLQDKTTEYARKTRRSVDLDKIRAKRDKFKKKVNDIIDIQEDDIPDWMR
    Newman          NVTNQTKIHLKQLQDKTTEYARKTRRSVDLDKIRAKRDKFKKKVNDIIDIQEDDIPDWMR
    USA300_FPR3757  NVTNQTKIHLKQLQDKTTEYARKTRRSVDLDKIRAKRDKFKKKVNDIIDIQEDDIPDWMR
                    ************************************************************

    COL             KPKWVKPMYVELFCGVVIFLFTFLEFNNRNALFVSGDWKLSQTQYVIEWVTLLILLFIII
    N315            KPKWVKPMYVELFCGVVIFLFTFLEFNNRNALFVSGDWKLSQTQYVIEWVTLLILLFIII
    NCTC8325        KPKWVKPMYVELFCGVVIFLFTFLEFNNRNALFVSGDWKLSQTQYVIEWVTLLILLFIII
    Newman          KPKWVKPMYVELFCGVVIFLFTFLEFNNRNALFVSGDWKLSQTQYVIEWVTLLILLFIII
    USA300_FPR3757  KPKWVKPMYVELFCGVVIFLFTFLEFNNRNALFVSGDWKLSQTQYVIEWVTLLILLFIII
                    ************************************************************

    COL             AYIATTLTFHLKGKFYYLQLFMGSILFFKLLTEFINIMIHGLLLSVFITPTLLLMLLAII
    N315            AYIATTLTFHLKGKFYYLQLFMGSILFFKLLTEFINIMIHGLLLSVFITPTLLLMLLAII
    NCTC8325        AYIATTLTFHLKGKFYYLQLFMGSILFFKLLTEFINIMIHGLLLSVFITPTLLLMLLAII
    Newman          AYIATTLTFHLKGKFYYLQLFMGSILFFKLLTEFINIMIHGLLLSVFITPTLLLMLLAII
    USA300_FPR3757  AYIATTLTFHLKGKFYYLQLFMGSILFFKLLTEFINIMIHGLLLSVFITPTLLLMLLAII
                    ************************************************************

    COL             ISYSLQLRERP
    N315            ISYSLQLRERP
    NCTC8325        ISYSLQLRERP
    Newman          ISYSLQLRERP
    USA300_FPR3757  ISYSLQLRERP
                    ***********