From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003302000
  • symbol?:
  • description?: Radical activating enzyme protein
  • strand?: +
  • coordinates?: 3673046..3673588
  • synteny block?: BlockID0023860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1038
    08BA02176:
    C248_1108
    11819-97:
    MS7_1039
    71193:
    ST398NM01_1079
    ECT-R 2:
    ECTR2_937
    ED133:
    SAOV_1026
    ED98:
    SAAV_1047
    HO 5096 0412:
    SAEMRSA15_09120
    JH1:
    SaurJH1_1164
    JH9:
    SaurJH9_1142
    JKD6008:
    SAA6008_01037
    JKD6159:
    SAA6159_00938
    LGA251:
    SARLGA251_09950
    M013:
    M013TW_1014
    MRSA252:
    SAR1055
    MSHR1132:
    SAMSHR1132_09290
    MSSA476:
    SAS1017
    Mu3:
    SAHV_1074
    Mu50:
    SAV1082
    MW2:
    MW0964
    RF122:
    SAB0948
    ST398:
    SAPIG1079
    T0131:
    SAT0131_01118
    TCH60:
    HMPREF0772_12151
    TW20:
    SATW20_10770
    USA300_TCH1516:
    USA300HOU_1024
    VC40:
    SAVC_04570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGFKNNLTSNLTNKIGNSVFKIENVDGKGAMPTTIQELRERRQRAEAIVKRKSLMSSTMS
    N315            MGFKNNLTSNLTNKIGNSVFKIENVDGKGAMPTTIQELRERRQRAEAIVKRKSLMSSTMS
    NCTC8325        MGFKNNLTSNLTNKIGNSVFKIENVDGKGAMPTTIQELRERRQRAEAIVKRKSLMSSTMS
    Newman          MGFKNNLTSNLTNKIGNSVFKIENVDGKGAMPTTIQELRERRQRAEAIVKRKSLMSSTMS
    USA300_FPR3757  MGFKNNLTSNLTNKIGNSVFKIENVDGKGAMPTTIQELRERRQRAEAIVKRKSLMSSTMS
                    ************************************************************

    COL             VVPIPGLDFGVDLKLMKDIIEDVNKIYGLDHKQVNSLGDDVKERIMSAAAIQGSQFIGKR
    N315            VVPIPGLDFGVDLKLMKDIIEDVNKIYGLDHKQVNSLGDDVKERIMSAAAIQGSQFIGKR
    NCTC8325        VVPIPGLDFGVDLKLMKDIIEDVNKIYGLDHKQVNSLGDDVKERIMSAAAIQGSQFIGKR
    Newman          VVPIPGLDFGVDLKLMKDIIEDVNKIYGLDHKQVNSLGDDVKERIMSAAAIQGSQFIGKR
    USA300_FPR3757  VVPIPGLDFGVDLKLMKDIIEDVNKIYGLDHKQVNSLGDDVKERIMSAAAIQGSQFIGKR
                    ************************************************************

    COL             ISNAFLKIVIRDVAKRTAAKQTKWFPVVGQAVSASISYYFMNKIGKDHIQKCENVIKNVM
    N315            ISSAFLKIVIRDVAKRTAAKQTKWFPVVGQAVSASISYYFMNKIGKDHIQKCENVIKNVM
    NCTC8325        ISNAFLKIVIRDVAKRTAAKQTKWFPVVGQAVSASISYYFMNKIGKDHIQKCENVIKNVM
    Newman          ISNAFLKIVIRDVAKRTAAKQTKWFPVVGQAVSASISYYFMNKIGKDHIQKCENVIKNVM
    USA300_FPR3757  ISNAFLKIVIRDVAKRTAAKQTKWFPVVGQAVSASISYYFMNKIGKDHIQKCENVIKNVM
                    **.*********************************************************