From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003303000
  • symbol?: ptsH
  • description?: phosphocarrier protein HPr

      descriptions from strain specific annotations:

    • phosphocarrier protein HPr
    • histidine-containing phosphocarrier protein(HPr)
    • phosphocarrier protein HPr (Histidine-containingprotein)
    • Phosphocarrier protein of PTS system
    • PTS family porter, phosphocarrier protein HPR
  • strand?: +
  • coordinates?: 3673706..3674008
  • synteny block?: BlockID0023870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1091 (ptsH)
    N315:
    SA0934 (ptsH)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1039 (ptsH)
    08BA02176:
    C248_1109 (ptsH)
    11819-97:
    MS7_1040 (ptsH)
    71193:
    ST398NM01_1080
    ECT-R 2:
    ECTR2_938
    ED133:
    SAOV_1027
    ED98:
    SAAV_1048 (ptsH)
    HO 5096 0412:
    SAEMRSA15_09130 (ptsH)
    JH1:
    SaurJH1_1165
    JH9:
    SaurJH9_1143
    JKD6008:
    SAA6008_01038
    JKD6159:
    SAA6159_00939
    LGA251:
    SARLGA251_09960 (ptsH)
    M013:
    M013TW_1015
    MRSA252:
    SAR1056 (ptsH)
    MSHR1132:
    SAMSHR1132_09300
    MSSA476:
    SAS1018
    Mu3:
    SAHV_1075 (ptsH)
    Mu50:
    SAV1083 (ptsH)
    MW2:
    MW0965 (ptsH)
    RF122:
    SAB0949 (ptsH)
    ST398:
    SAPIG1080
    T0131:
    SAT0131_01119
    TCH60:
    HMPREF0772_12150 (ptsH)
    TW20:
    SATW20_10780 (ptsH)
    USA300_TCH1516:
    USA300HOU_1025 (ptsH)
    VC40:
    SAVC_04575

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAE
    N315            MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAE
    NCTC8325        MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAE
    Newman          MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAE
    USA300_FPR3757  MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAE
                    ************************************************************

    COL             ITIYADGSDESDAIQAISDVLSKEGLTK
    N315            ITIYADGSDESDAIQAISDVLSKEGLTK
    NCTC8325        ITIYADGSDESDAIQAISDVLSKEGLTK
    Newman          ITIYADGSDESDAIQAISDVLSKEGLTK
    USA300_FPR3757  ITIYADGSDESDAIQAISDVLSKEGLTK
                    ****************************