From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003323000
  • symbol?: potA
  • description?: spermidine/putrescine ABC transporter

      descriptions from strain specific annotations:

    • spermidine/putrescine ABC transporter
    • spermidine/putrescine import ATP-binding protein
    • Spermidine Putrescine transport ATP-binding protein potA
    • ABC transporter family protein
    • spermidine/putrescine ABC transporter ATP-binding protein
    • ABC transporter ATP binding protein
    • putrescine/spermidine ABC transporter ATPase
    • Spermidine/putrescine import ATP-binding protein PotA
    • putative ABC transport ATP-binding protein
    • putrescine transport ATP-binding protein PotA
    • spermidine/putrescine ABC superfamily ATP binding cassette transporter, ABC protein
    • spermidine/putrescine ATP-binding ABC transporter protein
    • spermidine/putrescine ABC transporter ATP-binding subunit
    • PotA protein
  • strand?: +
  • coordinates?: 3690506..3691600
  • synteny block?: BlockID0024070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0950 (potA)
    NCTC8325:
    Newman:
    NWMN_0965 (potA)
    USA300_FPR3757:
    04-02981:
    SA2981_1056 (potA)
    08BA02176:
    C248_1126
    11819-97:
    MS7_1056 (potA)
    71193:
    ST398NM01_1096
    ECT-R 2:
    ECTR2_954
    ED133:
    SAOV_1043
    ED98:
    SAAV_1064
    HO 5096 0412:
    SAEMRSA15_09290
    JH1:
    SaurJH1_1181
    JH9:
    SaurJH9_1159
    JKD6008:
    SAA6008_01054 (potA)
    JKD6159:
    SAA6159_00955 (potA)
    LGA251:
    SARLGA251_10120
    M013:
    M013TW_1031
    MRSA252:
    SAR1073
    MSHR1132:
    SAMSHR1132_09460
    MSSA476:
    SAS1034
    Mu3:
    SAHV_1091 (potA)
    Mu50:
    SAV1099 (potA)
    MW2:
    MW0982 (potA)
    RF122:
    SAB0965
    ST398:
    SAPIG1096
    T0131:
    SAT0131_01137
    TCH60:
    HMPREF0772_12133 (potA)
    TW20:
    SATW20_10940
    USA300_TCH1516:
    USA300HOU_1042 (potA)
    VC40:
    SAVC_04655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEPLLSLKSVSKSYDDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGE
    N315            MEPLLSLKSVSKSYDDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGE
    NCTC8325        MEPLLSLKSVSKSYDDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGE
    Newman          MEPLLSLKSVSKSYDDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGE
    USA300_FPR3757  MEPLLSLKSVSKSYDDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGE
                    ************************************************************

    COL             VIYQNKPIGNLPPNKRKVNTVFQDYALFPHLNVYDNIAFGLKLKKLSKTEIDQKVTEALK
    N315            VIYQNKPIGNLPPNKRKVNTVFQDYALFPHLNVYDNIAFGLKLKKLSKTEIDQKVTEALK
    NCTC8325        VIYQNKPIGNLPPNKRKVNTVFQDYALFPHLNVYDNIAFGLKLKKLSKTEIDQKVTEALK
    Newman          VIYQNKPIGNLPPNKRKVNTVFQDYALFPHLNVYDNIAFGLKLKKLSKTEIDQKVTEALK
    USA300_FPR3757  VIYQNKPIGNLPPNKRKVNTVFQDYALFPHLNVYDNIAFGLKLKKLSKTEIDQKVTEALK
                    ************************************************************

    COL             LVKLSGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELREL
    N315            LVKLSGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELREL
    NCTC8325        LVKLSGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELREL
    Newman          LVKLSGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELREL
    USA300_FPR3757  LVKLSGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELREL
                    ************************************************************

    COL             QSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNI
    N315            QSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNI
    NCTC8325        QSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNI
    Newman          QSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNI
    USA300_FPR3757  QSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNI
                    ************************************************************

    COL             VEGRMVRDYVVNIYGQDFECVDMGIPENKKVEVVIRPEDISLIKAEEGLFKATVDSMLFR
    N315            VEGRMVRDYVVNIYGQDFECVDMGIPENKKVEVVIRPEDISLIKAEEGLFKATVDSMLFR
    NCTC8325        VEGRMVRDYVVNIYGQDFECVDMGIPENKKVEVVIRPEDISLIKAEEGLFKATVDSMLFR
    Newman          VEGRMVRDYVVNIYGQDFECVDMGIPENKKVEVVIRPEDISLIKAEEGLFKATVDSMLFR
    USA300_FPR3757  VEGRMVRDYVVNIYGQDFECVDMGIPENKKVEVVIRPEDISLIKAEEGLFKATVDSMLFR
                    ************************************************************

    COL             GVHYEICCIDNKGYEWVIQTTKKAEVGSEVGLYFDPEAIHIMVPGETEEEFDKRIESYEE
    N315            GVHYEICCIDNKGYEWVIQTTKKAEVGSEVGLYFDPEAIHIMVPGETEEEFDKRIESYEE
    NCTC8325        GVHYEICCIDNKGYEWVIQTTKKAEVGSEVGLYFDPEAIHIMVPGETEEEFDKRIESYEE
    Newman          GVHYEICCIDNKGYEWVIQTTKKAEVGSEVGLYFDPEAIHIMVPGETEEEFDKRIESYEE
    USA300_FPR3757  GVHYEICCIDNKGYEWVIQTTKKAEVGSEVGLYFDPEAIHIMVPGETEEEFDKRIESYEE
                    ************************************************************

    COL             VDNA
    N315            VDNA
    NCTC8325        VDNA
    Newman          VDNA
    USA300_FPR3757  VDNA
                    ****