From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003326000
  • symbol?: potD
  • description?: spermidine/putrescine ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • spermidine/putrescine ABC transporter substrate-binding protein
    • spermidine/putrescine ABC transporter binding protein
    • spermidine/putrescine ABC transporter spermidine/putrescine-binding protein
    • ABC transporter, periplasmic spermidine putrescine-binding protein potD
    • ABC transporter extracellular binding protein
    • bacterial extracellular solute-binding family protein
    • extracellular solute-binding family protein
    • extracellular solute-binding protein
    • spermidine/putrescine ABC superfamily ATP binding cassette transporter, binding protein
    • Spermidine/putrescine ABC transporter, binding protein
    • spermidine/putrescine ABC transporter, spermidine
    • spermidine/putrescine ABC transporter ATP-binding protein
    • spermidine/putrescine-binding periplasmic protein precursor
    • Spermidine/putrescine-binding protein
    • spermidine/putrescine-binding protein -like protein
    • spermidine/putrescine-binding protein precursor-like protein
  • strand?: +
  • coordinates?: 3693206..3694279
  • synteny block?: BlockID0024100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0953 (potD)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1059 (potD)
    08BA02176:
    C248_1129
    11819-97:
    MS7_1059
    71193:
    ST398NM01_1099
    ECT-R 2:
    ECTR2_957
    ED133:
    SAOV_1046
    ED98:
    SAAV_1067
    HO 5096 0412:
    SAEMRSA15_09320
    JH1:
    SaurJH1_1184
    JH9:
    SaurJH9_1162
    JKD6008:
    SAA6008_01057 (potD)
    JKD6159:
    SAA6159_00958 (potD)
    LGA251:
    SARLGA251_10150
    M013:
    M013TW_1034
    MRSA252:
    SAR1076
    MSHR1132:
    SAMSHR1132_09490
    MSSA476:
    SAS1037
    Mu3:
    SAHV_1094 (potD)
    Mu50:
    SAV1102 (potD)
    MW2:
    MW0985 (potD)
    RF122:
    SAB0968
    ST398:
    SAPIG1099
    T0131:
    SAT0131_01140
    TCH60:
    HMPREF0772_12130 (potD)
    TW20:
    SATW20_10970
    USA300_TCH1516:
    USA300HOU_1043 (potD)
    VC40:
    SAVC_04670

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRFLQLIIGALVVGMLCLTLSHWFKSKEQVHTNQKIYVYNWGEYIDPELIKKFEKETGI
    N315            MKRFLQLIIGALVVGMLCLTLSHWFKSKEQVHTNQKIYVYNWGEYIDPELIKKFEKETGI
    NCTC8325        MKRFLQLIIGALVVGMLCLTLSHWFKSKEQVHTNQKIYVYNWGEYIDPELIKKFEKETGI
    Newman          MKRFLQLIIGALVVGMLCLTLSHWFKSKEQVHTNQKIYVYNWGEYIDPELIKKFEKETGI
    USA300_FPR3757  MKRFLQLIIGALVVGMLCLTLSHWFKSKEQVHTNQKIYVYNWGEYIDPELIKKFEKETGI
                    ************************************************************

    COL             QVVYETFDSNEAMEAKIRNGGTHYDVAFPSEYTVQKLKRDHLLLPIDHNKVPNIKNLDSD
    N315            QVVYETFDSNEAMEAKIRNGGTHYDVAFPSEYTVQKLKRDHLLLPIDHNKVPNIKNLDSD
    NCTC8325        QVVYETFDSNEAMEAKIRNGGTHYDVAFPSEYTVQKLKRDHLLLPIDHNKVPNIKNLDSD
    Newman          QVVYETFDSNEAMEAKIRNGGTHYDVAFPSEYTVQKLKRDHLLLPIDHNKVPNIKNLDSD
    USA300_FPR3757  QVVYETFDSNEAMEAKIRNGGTHYDVAFPSEYTVQKLKRDHLLLPIDHNKVPNIKNLDSD
                    ************************************************************

    COL             YMNMSFDRGNKYSLPYFFGTVGILYNKEKYPNESFDSWKSLYNPKFKNQILLVDGAREII
    N315            YMNMSFDKGNKYSLPYFFGTVGILYNKEKYPNESFDSWKSLYNPKFKNQILLVDGAREII
    NCTC8325        YMNMSFDRGNKYSLPYFFGTVGILYNKEKYPNESFDSWKSLYNPKFKNQILLVDGAREII
    Newman          YMNMSFDRGNKYSLPYFFGTVGILYNKEKYPNESFDSWKSLYNPKFKNQILLVDGAREII
    USA300_FPR3757  YMNMSFDRGNKYSLPYFFGTVGILYNKEKYPNESFDSWKSLYNPKFKNQILLVDGAREII
                    *******:****************************************************

    COL             GMSLNKLGYNLNDRNSHHLKEAERDLTKLAPQVRGVVGDEITMMLQQNEGNIAVVWSGVA
    N315            GMSLNKLGYNLNDRNSHHLKEAERDLTKLAPQVRGVVGDEITMMLQQNEGNIAVVWSGVA
    NCTC8325        GMSLNKLGYNLNDRNSHHLKEAERDLTKLAPQVRGVVGDEITMMLQQNEGNIAVVWSGVA
    Newman          GMSLNKLGYNLNDRNSHHLKEAERDLTKLAPQVRGVVGDEITMMLQQNEGNIAVVWSGVA
    USA300_FPR3757  GMSLNKLGYNLNDRNSHHLKEAERDLTKLAPQVRGVVGDEITMMLQQNEGNIAVVWSGVA
                    ************************************************************

    COL             APLVQEGDKYNYVIPKEGSNLWFDNMVIPKTAQNKEGAYKFMNFLLDAKNNKQNTEFVGY
    N315            APLVQEGDKYNYVIPKEGSNLWFDNMVIPKTAQNKEGAYKFMNFLLDAKNNKQNTEFVGY
    NCTC8325        APLVQEGDKYNYVIPKEGSNLWFDNMVIPKTAQNKEGAYKFMNFLLDAKNNKQNTEFVGY
    Newman          APLVQEGDKYNYVIPKEGSNLWFDNMVIPKTAQNKEGAYKFMNFLLDAKNNKQNTEFVGY
    USA300_FPR3757  APLVQEGDKYNYVIPKEGSNLWFDNMVIPKTAQNKEGAYKFMNFLLDAKNNKQNTEFVGY
                    ************************************************************

    COL             ATPNKAARQLLPKEIKDDHRFYPTKKEQERLEVYKDLGPEVLSEYNENFLNFKMSLK
    N315            ATPNKAARQLLPKEIKDDHRFYPTKKEQERLEVYKDLGPEVLSEYNENFLNFKMSLK
    NCTC8325        ATPNKAARQLLPKEIKDDHRFYPTKKEQERLEVYKDLGPEVLSEYNENFLNFKMSLK
    Newman          ATPNKAARQLLPKEIKDDHRFYPTKKEQERLEVYKDLGPEVLSEYNENFLNFKMSLK
    USA300_FPR3757  ATPNKAARQLLPKEIKDDHRFYPTKKEQERLEVYKDLGPEVLSEYNENFLNFKMSLK
                    *********************************************************