From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003329000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 3697298..3697732
  • synteny block?: BlockID0024130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1061
    08BA02176:
    C248_1131
    11819-97:
    MS7_1061
    71193:
    ST398NM01_1101
    ECT-R 2:
    ECTR2_959
    ED133:
    SAOV_1048
    ED98:
    SAAV_1070
    HO 5096 0412:
    SAEMRSA15_09340
    JH1:
    SaurJH1_1186
    JH9:
    SaurJH9_1164
    JKD6008:
    SAA6008_01059
    JKD6159:
    SAA6159_00960
    LGA251:
    SARLGA251_10170
    M013:
    M013TW_1036
    MRSA252:
    SAR1078
    MSHR1132:
    SAMSHR1132_09510
    MSSA476:
    SAS1039
    Mu3:
    SAHV_1096
    Mu50:
    SAV1104
    MW2:
    MW0987
    RF122:
    SAB0970
    ST398:
    SAPIG1101
    T0131:
    SAT0131_01143 (lacG)
    TCH60:
    HMPREF0772_12128
    TW20:
    SATW20_10990
    USA300_TCH1516:
    USA300HOU_1045
    VC40:
    SAVC_04680

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNRKPELIMAWIANSISIIYLLVMGLSYFSLKSGNASQREELAKQLSQNGGKVSLDMLQT
    N315            MNRKPELIMAWIANSISIIYLLVMGLSYFSLKSGNASQREELAKQLSQNGGNVSLDMLQT
    NCTC8325        MNRKPELIMAWIANSISIIYLLVMGLSYFSLKSGNASQREELAKQLSQNGGKVSLDMLQT
    Newman          MNRKPELIMAWIANSISIIYLLVMGLSYFSLKSGNASQREELAKQLSQNGGKVSLDMLQT
    USA300_FPR3757  MNRKPELIMAWIANSISIIYLLVMGLSYFSLKSGNASQREELAKQLSQNGGKVSLDMLQT
                    ***************************************************:********

    COL             TMGALAIILLISTLYGIFATICIKGRRKLSIILFVIAIIVSLMALNLIAIVLWVIVMIML
    N315            TMGALAIILLISTLYGIFATICIKGRRKLSIILFVIAIIVSLMALNLIAIVLWVIVMIML
    NCTC8325        TMGALAIILLISTLYGIFATICIKGRRKLSIILFVIAIIVSLMALNLIAIVLWVIVMIML
    Newman          TMGALAIILLISTLYGIFATICIKGRRKLSIILFVIAIIVSLMALNLIAIVLWVIVMIML
    USA300_FPR3757  TMGALAIILLISTLYGIFATICIKGRRKLSIILFVIAIIVSLMALNLIAIVLWVIVMIML
                    ************************************************************

    COL             ISKKESKETTHKDDEYIYH
    N315            ISKKESKETTHKDDEYIYH
    NCTC8325        ISKKESKETTHKDDEYIYH
    Newman          ISKKESKETTHKDDEYIYH
    USA300_FPR3757  ISKKESKETTHKDDEYIYH
                    *******************