From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003332000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3699412..3700026
  • synteny block?: BlockID0024160
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1063
    08BA02176:
    C248_1133
    11819-97:
    MS7_1063
    71193:
    ST398NM01_1103
    ECT-R 2:
    ECTR2_961
    ED133:
    SAOV_1050c
    ED98:
    SAAV_1072
    HO 5096 0412:
    SAEMRSA15_09360
    JH1:
    SaurJH1_1188
    JH9:
    SaurJH9_1166
    JKD6008:
    SAA6008_01061
    JKD6159:
    SAA6159_00962
    LGA251:
    SARLGA251_10190
    M013:
    M013TW_1038
    MRSA252:
    SAR1080
    MSHR1132:
    SAMSHR1132_09530
    MSSA476:
    SAS1041
    Mu3:
    SAHV_1098
    Mu50:
    SAV1106
    MW2:
    MW0989
    RF122:
    SAB0972c
    ST398:
    SAPIG1103
    T0131:
    SAT0131_01145
    TCH60:
    HMPREF0772_12126
    TW20:
    SATW20_11010
    USA300_TCH1516:
    VC40:
    SAVC_04695

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLRELGEYFSDFFTSQTGETFYPHVAKH
    N315            MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKH
    NCTC8325        MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLRELGEYFSDFFTSQTGETFYPHVAKH
    Newman          MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLRELGEYFSDFFTSQTGETFYPHVAKH
    USA300_FPR3757  MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLRELGEYFSDFFTSQTGETFYPHVAKH
                    **********************************:*************************

    COL             ARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAKDKATRAKVFERK
    N315            ARRSVNAPKDTWVAFATSKRGYKMLPHFQIGMFEDQLFVMFGIMHEAKDKATRAKVFERK
    NCTC8325        ARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAKDKATRAKVFERK
    Newman          ARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAKDKATRAKVFERK
    USA300_FPR3757  ARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAKDKATRAKVFERK
                    ******.**********.******************************************

    COL             FKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLIEAIQRAINVKKGEFFIARAITPQDKR
    N315            FKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINVKKGEFFIARAITPQDKR
    NCTC8325        FKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLIEAIQRAINVKKGEFFIARAITPQDKR
    Newman          FKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLIEAIQRAINVKKGEFFIARAITPQDKR
    USA300_FPR3757  FKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLIEAIQRAINVKKGEFFIARAITPQDKR
                    ********************************* **************************

    COL             LKSDKAFIAFLEETFDQFLPFYSA
    N315            LKSDKAFIAFLEETFDQFLPFYSA
    NCTC8325        LKSDKAFIAFLEETFDQFLPFYSA
    Newman          LKSDKAFIAFLEETFDQFLPFYSA
    USA300_FPR3757  LKSDKAFIAFLEETFDQFLPFYSA
                    ************************