From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003333000
  • symbol?:
  • description?: inositol monophosphatase

      descriptions from strain specific annotations:

    • inositol monophosphatase
    • inositol monophosphatase family protein
    • inositol-1-monophosphatase family protein
    • Inositol-1-monophosphatase
    • inositol-1-monophosphatase (IMPase) (Inositol-1-phosphatase) (I-1-Pase)
    • inositol-phosphate phosphatase
    • myo-inositol-1#or 4-monophosphatase homologue
    • Myo-inositol-1(or 4)-monophosphatase
    • myo-inositol-1(or 4)-monophosphatase-like protein
  • strand?: +
  • coordinates?: 3700166..3701011
  • synteny block?: BlockID0024170
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1064
    08BA02176:
    C248_1134
    11819-97:
    MS7_1064
    71193:
    ST398NM01_1104
    ECT-R 2:
    ECTR2_962
    ED133:
    SAOV_1051
    ED98:
    SAAV_1073
    HO 5096 0412:
    SAEMRSA15_09370
    JH1:
    SaurJH1_1189
    JH9:
    SaurJH9_1167
    JKD6008:
    SAA6008_01062
    JKD6159:
    SAA6159_00963
    LGA251:
    SARLGA251_10200
    M013:
    M013TW_1039
    MRSA252:
    SAR1081
    MSHR1132:
    SAMSHR1132_09540
    MSSA476:
    SAS1042
    Mu3:
    SAHV_1099
    Mu50:
    SAV1107
    MW2:
    MW0990
    RF122:
    SAB0973
    ST398:
    SAPIG1104
    T0131:
    SAT0131_01146 (lacE)
    TCH60:
    HMPREF0772_12125 (suhB2)
    TW20:
    SATW20_11020
    USA300_TCH1516:
    VC40:
    SAVC_04700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALYGFAQGLIQEAGIRIKQLMEQNLTIETKSNPNDLVTNVDKATEDFIFDTILETYPNH
    N315            MALYGFAQGLIQEAGIRIKQLMEQNLTIETKSNPNDLVTNVDKATEDFIFDTILETYPNH
    NCTC8325        MALYGFAQGLIQEAGIRIKQLMEQNLTIETKSNPNDLVTNVDKATEDFIFDTILETYPNH
    Newman          MALYGFAQGLIQEAGIRIKQLMEQNLTIETKSNPNDLVTNVDKATEDFIFDTILETYPNH
    USA300_FPR3757  MALYGFAQGLIQEAGIRIKQLMEQNLTIETKSNPNDLVTNVDKATEDFIFDTILETYPNH
                    ************************************************************

    COL             QVLGEEGHGHDIDTSKGTVWIVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMA
    N315            QVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMA
    NCTC8325        QVLGEEGHGHDIDTSKGTVWIVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMA
    Newman          QVLGEEGHGHDIDTSKGTVWIVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMA
    USA300_FPR3757  QVLGEEGHGHDIDTSKGTVWIVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMA
                    ********************:***************************************

    COL             DVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARA
    N315            DVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARA
    NCTC8325        DVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARA
    Newman          DVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARA
    USA300_FPR3757  DVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARA
                    ************************************************************

    COL             YGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSIL
    N315            YGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSIL
    NCTC8325        YGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSIL
    Newman          YGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSIL
    USA300_FPR3757  YGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSIL
                    ************************************************************

    COL             VGNRGLHQEISNDYLEPHHDALIQLHEQRFKRKSK
    N315            VGNRGLHQEISNDYLEPYHDTLIQLHEQRFKRKSK
    NCTC8325        VGNRGLHQEISNDYLEPHHDALIQLHEQRFKRKSK
    Newman          VGNRGLHQEISNDYLEPHHDALIQLHEQRFKRKSK
    USA300_FPR3757  VGNRGLHQEISNDYLEPHHDALIQLHEQRFKRKSK
                    *****************:**:**************