From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003335000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3701174..3701365
  • synteny block?: BlockID0024190
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1065
    08BA02176:
    C248_1135
    11819-97:
    MS7_1065
    71193:
    ST398NM01_1105
    ECT-R 2:
    ECTR2_963
    ED133:
    ED98:
    SAAV_1074
    HO 5096 0412:
    SAEMRSA15_09380
    JH1:
    SaurJH1_1190
    JH9:
    SaurJH9_1168
    JKD6008:
    SAA6008_01063
    JKD6159:
    SAA6159_00964
    LGA251:
    SARLGA251_10210
    M013:
    M013TW_1040
    MRSA252:
    SAR1082
    MSHR1132:
    SAMSHR1132_09550
    MSSA476:
    SAS1043
    Mu3:
    SAHV_1100
    Mu50:
    SAV1108
    MW2:
    MW0991
    RF122:
    ST398:
    SAPIG1105
    T0131:
    SAT0131_01147
    TCH60:
    HMPREF0772_12124
    TW20:
    SATW20_11030
    USA300_TCH1516:
    VC40:
    SAVC_04705

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYREN
    N315            MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYREN
    USA300_FPR3757  MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYREN
                    ************************************************************

    COL             DWL
    N315            DWL
    USA300_FPR3757  DWL
                    ***