From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003339000
  • symbol?:
  • description?: protein BLi01701/
  • strand?: +
  • coordinates?: 3704249..3704554
  • synteny block?: BlockID0024230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1069
    08BA02176:
    C248_1139
    11819-97:
    MS7_1069
    71193:
    ST398NM01_1109
    ECT-R 2:
    ECTR2_967
    ED133:
    SAOV_1054
    ED98:
    SAAV_1078
    HO 5096 0412:
    SAEMRSA15_09420
    JH1:
    SaurJH1_1194
    JH9:
    SaurJH9_1172
    JKD6008:
    SAA6008_01067
    JKD6159:
    SAA6159_00967
    LGA251:
    SARLGA251_10250
    M013:
    M013TW_1044
    MRSA252:
    SAR1086
    MSHR1132:
    SAMSHR1132_09590
    MSSA476:
    SAS1047
    Mu3:
    SAHV_1104
    Mu50:
    SAV1112
    MW2:
    MW0995
    RF122:
    SAB0977
    ST398:
    SAPIG1109
    T0131:
    SAT0131_01151 (lacD)
    TCH60:
    HMPREF0772_12120
    TW20:
    SATW20_11070
    USA300_TCH1516:
    USA300HOU_1050
    VC40:
    SAVC_04725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAV
    N315            MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAV
    NCTC8325        MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAV
    Newman          MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAV
    USA300_FPR3757  MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAV
                    ************************************************************

    COL             KLGLVDREDGKQIMLRLEKELSKLHEAFTLV
    N315            KLGLVDREDGKQIMLRLEKELSKLHEAFTLV
    NCTC8325        KLGLVDREDGKQIMLRLEKELSKLHEAFTLV
    Newman          KLGLVDREDGKQIMLRLEKELSKLHEAFTLV
    USA300_FPR3757  KLGLVDREDGKQIMLRLEKELSKLHEAFTLV
                    *******************************