Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003344000
  • symbol?: ctaM
  • description?: Putative Heme biosynthesis related protein

      descriptions from strain specific annotations:

    • Putative Heme biosynthesis related protein
    • Protein of hypothetical function
    • membrane protein
    • membrane spanning protein
  • strand?: +
  • coordinates?: 3713183..3713653
  • synteny block?: BlockID0024280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1074
    08BA02176:
    C248_1144
    11819-97:
    MS7_1074
    71193:
    ST398NM01_1114
    ECT-R 2:
    ECTR2_972
    ED133:
    SAOV_1059
    ED98:
    SAAV_1083
    HO 5096 0412:
    SAEMRSA15_09470
    JH1:
    SaurJH1_1199
    JH9:
    SaurJH9_1177
    JKD6008:
    SAA6008_01072
    JKD6159:
    SAA6159_00972
    LGA251:
    SARLGA251_10300
    M013:
    M013TW_1049
    MRSA252:
    SAR1091
    MSHR1132:
    SAMSHR1132_09640
    MSSA476:
    SAS1052
    Mu3:
    SAHV_1109
    Mu50:
    SAV1117
    MW2:
    MW1000
    RF122:
    SAB0982
    ST398:
    SAPIG1114
    T0131:
    SAT0131_01156 (lacR)
    TCH60:
    HMPREF0772_12115
    TW20:
    SATW20_11120
    USA300_TCH1516:
    USA300HOU_1055
    VC40:
    SAVC_04750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGVPILPTISTTCIVISAILIAIGWRLIWKREINKHKNVMLAAAVFALTFFLIYASRTIF
    N315            MGVPILPTISTTCIVISAILIAIGWRLIWKREINKHKNVMLAAAVFALTFFLIYASRTIF
    NCTC8325        MGVPILPTISTTCIVISAILIAIGWRLIWKREINKHKNVMLAAAVFALTFFLIYASRTIF
    Newman          MGVPILPTISTTCIVISAILIAIGWRLIWKREINKHKNVMLAAAVFALTFFLIYASRTIF
    USA300_FPR3757  MGVPILPTISTTCIVISAILIAIGWRLIWKREINKHKNVMLAAAVFALTFFLIYASRTIF
                    ************************************************************

    COL             IGNTAFGGPASIKKYYTIFLFFHINLATIGGILGLVQIITAFKDKYNVHRKFGPFASVIW
    N315            IGNTAFGGPASIKKYYTIFLFFHINLATIGGILGLVQIITAFKDKYNVHRKFGPFASVIW
    NCTC8325        IGNTAFGGPASIKKYYTIFLFFHINLATIGGILGLVQIITAFKDKYNVHRKFGPFASVIW
    Newman          IGNTAFGGPASIKKYYTIFLFFHINLATIGGILGLVQIITAFKDKYNVHRKFGPFASVIW
    USA300_FPR3757  IGNTAFGGPASIKKYYTIFLFFHINLATIGGILGLVQIITAFKDKYNVHRKFGPFASVIW
                    ************************************************************

    COL             FCTAITGVAVYLLLYVLYPGGETTSLIKATFGH
    N315            FCTAITGVAVYLLLYVLYPGGETTSLIKATFGH
    NCTC8325        FCTAITGVAVYLLLYVLYPGGETTSLIKATFGH
    Newman          FCTAITGVAVYLLLYVLYPGGETTSLIKATFGH
    USA300_FPR3757  FCTAITGVAVYLLLYVLYPGGETTSLIKATFGH
                    *********************************