From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003346000
  • symbol?:
  • description?: Allergen V5/Tpx-1 like protein

      descriptions from strain specific annotations:

    • Allergen V5/Tpx-1 like protein
    • SCP-like extracellular family protein
    • SCP/PR1-like extracellular protein
    • SCP-like extracellular protein
    • cysteine-rich secretory family protein
    • allergen V5/Tpx-1 related protein
    • membrane protein
  • strand?: +
  • coordinates?: 3714029..3715069
  • synteny block?: BlockID0024300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1075
    08BA02176:
    C248_1145
    11819-97:
    MS7_1075
    71193:
    ST398NM01_1115
    ECT-R 2:
    ECTR2_973
    ED133:
    SAOV_1060
    ED98:
    SAAV_1085
    HO 5096 0412:
    SAEMRSA15_09480
    JH1:
    SaurJH1_1200
    JH9:
    SaurJH9_1178
    JKD6008:
    SAA6008_01073
    JKD6159:
    SAA6159_00973
    LGA251:
    SARLGA251_10310
    M013:
    M013TW_1050
    MRSA252:
    SAR1092
    MSHR1132:
    SAMSHR1132_09650
    MSSA476:
    SAS1053
    Mu3:
    SAHV_1110
    Mu50:
    SAV1118
    MW2:
    MW1001
    RF122:
    SAB0983
    ST398:
    SAPIG1115
    T0131:
    SAT0131_01157
    TCH60:
    HMPREF0772_12114
    TW20:
    SATW20_11130
    USA300_TCH1516:
    USA300HOU_1056
    VC40:
    SAVC_04755

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------------------------------------------MNKSNNHAENPKPK
    N315            MKKLIIRVVGVLFLVGFLIYLFYSPRLKFDVLENPNKGNKVNRSEQVNKSNNHAENPKPK
    NCTC8325        MKKLIIRVVGVLFLVGFLIYLFYSPRLKFDVLENPNKGNKVNRSEQVNKSNNHAENPKPK
    Newman          MKKLIIRVVGVLFLVGFLIYLFYSPRLKFDVLENPNKGNKVNRSEQVNKSNNHAENPKPK
    USA300_FPR3757  MKKLIIRVVGVLFLVGFLIYLFYSPRLKFDVLENPNKGNKVNRSEQVNKSNNHAENPKPK
                                                                  :*************

    COL             EGVGTWVGKDIKVLTSKFGQADRVYPFRDGYKNYVFKDKNSYYIVSTKREEIVSVYATGE
    N315            EGVGTWVGKDIKVLTSKFGQADRVYPFRDGYKNYVFKDKNSYYIVSTKREEIVSVYATGE
    NCTC8325        EGVGTWVGKDIKVLTSKFGQADRVYPFRDGYKNYVFKDKNSYYIVSTKREEIVSVYATGE
    Newman          EGVGTWVGKDIKVLTSKFGQADRVYPFRDGYKNYVFKDKNSYYIVSTKREEIVSVYATGE
    USA300_FPR3757  EGVGTWVGKDIKVLTSKFGQADRVYPFRDGYKNYVFKDKNSYYIVSTKREEIVSVYATGE
                    ************************************************************

    COL             KVNVSPLKIGQHSAEIFNHTSINPEPSFKVDGKKYEFELSDEDLKTQTLIKYGDIYAQVY
    N315            KVNVSPLKIGQHSAEIFNHTSINPEPSFKVDGKKYEFELSDEDLKTQTLIKYGDIYAQVY
    NCTC8325        KVNVSPLKIGQHSAEIFNHTSINPEPSFKVDGKKYEFELSDEDLKTQTLIKYGDIYAQVY
    Newman          KVNVSPLKIGQHSAEIFNHTSINPEPSFKVDGKKYEFELSDEDLKTQTLIKYGDIYAQVY
    USA300_FPR3757  KVNVSPLKIGQHSAEIFNHTSINPEPSFKVDGKKYEFELSDEDLKTQTLIKYGDIYAQVY
                    ************************************************************

    COL             SDQQSKKVLSVRFLTKEMLADIEPYQLNSNSTSEEHNKRPVEQNPNQLISLYEVTNEMRK
    N315            SDQQSKKVLSVRFLTKEMLADIEPYQLNSNSTSEEHNKRPVEQNPNQLISLYEVTNEMRK
    NCTC8325        SDQQSKKVLSVRFLTKEMLADIEPYQLNSNSTSEEHNKRPVEQNPNQLISLYEVTNEMRK
    Newman          SDQQSKKVLSVRFLTKEMLADIEPYQLNSNSTSEEHNKRPVEQNPNQLISLYEVTNEMRK
    USA300_FPR3757  SDQQSKKVLSVRFLTKEMLADIEPYQLNSNSTSEEHNKRPVEQNPNQLISLYEVTNEMRK
                    ************************************************************

    COL             LKGLKPLKINSDLAHIASNNLYEATSNGSDSVEFTEDALRGQLDKNHVTYKTTAQNVGYA
    N315            LKGLKPLKINSDLAHIASNNLYEATSNGSDSVEFTEDALRGQLDKNHVTYKTTAQNVGYA
    NCTC8325        LKGLKPLKINSDLAHIASNNLYEATSNGSDSVEFTEDALRGQLDKNHVTYKTTAQNVGYA
    Newman          LKGLKPLKINSDLAHIASNNLYEATSNGSDSVEFTEDALRGQLDKNHVTYKTTAQNVGYA
    USA300_FPR3757  LKGLKPLKINSDLAHIASNNLYEATSNGSDSVEFTEDALRGQLDKNHVTYKTTAQNVGYA
                    ************************************************************

    COL             FNDVPTLIHSWMNSDIHRSRLLNSKYDEMGGDVMRDYYSLIFLEK
    N315            FNDVPTLIHSWMNSDIHRSRLLNSKYDEMGGDVMRDYYSLIFLEK
    NCTC8325        FNDVPTLIHSWMNSDIHRSRLLNSKYDEMGGDVMRDYYSLIFLEK
    Newman          FNDVPTLIHSWMNSDIHRSRLLNSKYDEMGGDVMRDYYSLIFLEK
    USA300_FPR3757  FNDVPTLIHSWMNSDIHRSRLLNSKYDEMGGDVMRDYYSLIFLEK
                    *********************************************