Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003348000
  • symbol?:
  • description?: glycerophosphoryl diester phosphodiesterase

      descriptions from strain specific annotations:

    • glycerophosphoryl diester phosphodiesterase
    • glycerophosphoryl diester phosphodiesterase, putative
    • glycerophosphoryl diester phosphodiesterase family protein
    • glycerophosphodiester phosphodiesterase
    • exported protein
  • strand?: -
  • coordinates?: 3715631..3716741
  • synteny block?: BlockID0024320
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1077
    08BA02176:
    C248_1147
    11819-97:
    MS7_1077
    71193:
    ST398NM01_1117
    ECT-R 2:
    ECTR2_975
    ED133:
    SAOV_1062c
    ED98:
    SAAV_1087
    HO 5096 0412:
    SAEMRSA15_09500
    JH1:
    SaurJH1_1202
    JH9:
    SaurJH9_1180
    JKD6008:
    SAA6008_01075
    JKD6159:
    SAA6159_00975
    LGA251:
    SARLGA251_10330
    M013:
    M013TW_1052
    MRSA252:
    SAR1094
    MSHR1132:
    SAMSHR1132_09670
    MSSA476:
    SAS1055
    Mu3:
    SAHV_1112
    Mu50:
    SAV1121
    MW2:
    MW1003
    RF122:
    SAB0985c
    ST398:
    SAPIG1117
    T0131:
    SAT0131_01159
    TCH60:
    HMPREF0772_12112
    TW20:
    SATW20_11150
    USA300_TCH1516:
    VC40:
    SAVC_04765

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKVNRNILNAVLVGAGFLSSLLMINKNKVITKKQTIPAFFKGNAPYIFAHRGGMALRPE
    N315            MKKVNRNILNAVLVGAGFLSSLLMINKNKVITKKQTIPAFFKGNAPYIFAHRGGMALRPE
    NCTC8325        MKKVNRNILNAVLVGAGFLSSLLMINKNKVITKKQTIPAFFKGNAPYIFAHRGGMALRPE
    Newman          MKKVNRNILNAVLVGAGFLSSLLMINKNKVITKKQTIPAFFKGNAPYIFAHRGGMALRPE
    USA300_FPR3757  MKKVNRNILNAVLVGAGFLSSLLMINKNKVITKKQTIPAFFKGNAPYIFAHRGGMALRPE
                    ************************************************************

    COL             QTQLAFDYAKQLGVDGFETDVRLTKDQQLIVFHDATVDRTTNGSGKVSAHTLAELKKLDA
    N315            QTQLAFDYAKQLGVDGFETDVRLTKDQQLIVFHDATVDRTTNGSGKVSAHTLAELKKLDA
    NCTC8325        QTQLAFDYAKQLGVDGFETDVRLTKDQQLIVFHDATVDRTTNGSGKVSAHTLAELKKLDA
    Newman          QTQLAFDYAKQLGVDGFETDVRLTKDQQLIVFHDATVDRTTNGSGKVSAHTLAELKKLDA
    USA300_FPR3757  QTQLAFDYAKQLGVDGFETDVRLTKDQQLIVFHDATVDRTTNGSGKVSAHTLAELKKLDA
                    ************************************************************

    COL             AYHFKDINGLTPYRGHAHTAILTFDELLKQYPDMYINVDLKDAPESYEGSIAPQIMFDTI
    N315            AYHFKDINGLTPYRGHAHTTILTFDELLKQYPDMYINVDLKDAPESYEGSIAPQIMFDTI
    NCTC8325        AYHFKDINGLTPYRGHAHTAILTFDELLKQYPDMYINVDLKDAPESYEGSIAPQIMFDTI
    Newman          AYHFKDINGLTPYRGHAHTAILTFDELLKQYPDMYINVDLKDAPESYEGSIAPQIMFDTI
    USA300_FPR3757  AYHFKDINGLTPYRGHAHTAILTFDELLKQYPDMYINVDLKDAPESYEGSIAPQIMFDTI
                    *******************:****************************************

    COL             AENQAFDRVLVTSFYKEQIVRFNKIAQGSVAIGASQQEVTEAFLKYHLLGGRYYQPLAQT
    N315            AENQAFDRVLVTSFYKEQIVRFNKIAQGSVAIGASQQEVTEAFLKYHLLGGRYYQPLAQT
    NCTC8325        AENQAFDRVLVTSFYKEQIVRFNKIAQGSVAIGASQQEVTEAFLKYHLLGGRYYQPLAQT
    Newman          AENQAFDRVLVTSFYKEQIVRFNKIAQGSVAIGASQQEVTEAFLKYHLLGGRYYQPLAQT
    USA300_FPR3757  AENQAFDRVLVTSFYKEQIVRFNKIAQGSVAIGASQQEVTEAFLKYHLLGGRYYQPLAQT
                    ************************************************************

    COL             FQMPTHFKGIDLTSSRFIKWLNDMNIIPGYYGVNSINLMNDLYQKGAHTIVTDRPDLAQQ
    N315            FQMPTHFKGIDLTSSRFIKWLNDMNIIPGYYGVNSIDLMNDLYQKGAHTIVTDRPDLAQQ
    NCTC8325        FQMPTHFKGIDLTSSRFIKWLNDMNIIPGYYGVNSINLMNDLYQKGAHTIVTDRPDLAQQ
    Newman          FQMPTHFKGIDLTSSRFIKWLNDMNIIPGYYGVNSINLMNDLYQKGAHTIVTDRPDLAQQ
    USA300_FPR3757  FQMPTHFKGIDLTSSRFIKWLNDMNIIPGYYGVNSINLMNDLYQKGAHTIVTDRPDLAQQ
                    ************************************:***********************

    COL             FKQTIPNK
    N315            FKQTIPNK
    NCTC8325        FKQTIPNK
    Newman          FKQTIPNK
    USA300_FPR3757  FKQTIPNK
                    ********