From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003350000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3717246..3717635
  • synteny block?: BlockID0024340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1079
    08BA02176:
    C248_1149
    11819-97:
    MS7_1079
    71193:
    ST398NM01_1119
    ECT-R 2:
    ECTR2_977
    ED133:
    SAOV_1064c
    ED98:
    SAAV_1089
    HO 5096 0412:
    SAEMRSA15_09520
    JH1:
    SaurJH1_1204
    JH9:
    SaurJH9_1182
    JKD6008:
    SAA6008_01077
    JKD6159:
    SAA6159_00977
    LGA251:
    SARLGA251_10350
    M013:
    M013TW_1054
    MRSA252:
    SAR1096
    MSHR1132:
    SAMSHR1132_09690
    MSSA476:
    SAS1057
    Mu3:
    SAHV_1114
    Mu50:
    SAV1123
    MW2:
    MW1005
    RF122:
    SAB0987c
    ST398:
    SAPIG1119
    T0131:
    SAT0131_01161
    TCH60:
    HMPREF0772_12110
    TW20:
    SATW20_11170
    USA300_TCH1516:
    USA300HOU_1060
    VC40:
    SAVC_04775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQTFITLGEGLTDLFEFMTMIEYNHQRIDKIIYFHSPQAENKKSSVAIIMNPTTGNHFQ
    N315            MKQTFITLGEGLTDLFEFMTMIEYNHQRIDKIIYFHSPQAENKKSSVAIIMNPTTGNHFQ
    NCTC8325        MKQTFITLGEGLTDLFEFMTMIEYNHQRIDKIIYFHSPQAENKKSSVAIIMNPTTGNHFQ
    Newman          MKQTFITLGEGLTDLFEFMTMIEYNHQRIDKIIYFHSPQAENKKSSVAIIMNPTTGNHFQ
    USA300_FPR3757  MKQTFITLGEGLTDLFEFMTMIEYNHQRIDKIIYFHSPQAENKKSSVAIIMNPTTGNHFQ
                    ************************************************************

    COL             AFYIMINAIKYPYPDSNKKFQMINDCAEKFDIPILGIDVQPPQAFHDLSLYYNYLISVLR
    N315            AFYIMINAIKYPYPDSNKKFQMINDCAEKFDIPILGIDVQPPQAFHDLSLYYNYLISVLR
    NCTC8325        AFYIMINAIKYPYPDSNKKFQMINDCAEKFDIPILGIDVQPPQAFHDLSLYYNYLISVLR
    Newman          AFYIMINAIKYPYPDSNKKFQMINDCAEKFDIPILGIDVQPPQAFHDLSLYYNYLISVLR
    USA300_FPR3757  AFYIMINAIKYPYPDSNKKFQMINDCAEKFDIPILGIDVQPPQAFHDLSLYYNYLISVLR
                    ************************************************************

    COL             LQKWIPELQ
    N315            LQKWIPELQ
    NCTC8325        LQKWIPELQ
    Newman          LQKWIPELQ
    USA300_FPR3757  LQKWIPELQ
                    *********