From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003354000
  • symbol?:
  • description?: YlbN-like protein

      descriptions from strain specific annotations:

    • YlbN-like protein
    • nucleic acid-binding protein
    • protein in cluster with ribosomal protein L32p
  • strand?: +
  • coordinates?: 3720059..3720616
  • synteny block?: BlockID0024380
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1083 (ylbN)
    08BA02176:
    C248_1153
    11819-97:
    MS7_1083
    71193:
    ST398NM01_1123
    ECT-R 2:
    ECTR2_981
    ED133:
    SAOV_1068
    ED98:
    SAAV_1093
    HO 5096 0412:
    SAEMRSA15_09560
    JH1:
    SaurJH1_1208
    JH9:
    SaurJH9_1186
    JKD6008:
    SAA6008_01081
    JKD6159:
    SAA6159_00981
    LGA251:
    SARLGA251_10390
    M013:
    M013TW_1058
    MRSA252:
    SAR1100
    MSHR1132:
    SAMSHR1132_09730
    MSSA476:
    SAS1061
    Mu3:
    SAHV_1118
    Mu50:
    SAV1127
    MW2:
    MW1009
    RF122:
    SAB0991
    ST398:
    SAPIG1123
    T0131:
    SAT0131_01165
    TCH60:
    HMPREF0772_12106
    TW20:
    SATW20_11210
    USA300_TCH1516:
    VC40:
    SAVC_04795

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKWSITQLRKYQGKPFEFDQTVSFDNLKESLDLIDLSPITIQGQLTIKSTEVVADIHITG
    N315            MKWSITQLRKYQGKPFEFDQTVSFDNLKESLDLIDLSPITIQGQLTIKSTEVVADIHITG
    NCTC8325        MKWSITQLRKYQGKPFEFDQTVSFDNLKESLDLIDLSPITIQGQLTIKSTEVVADIHITG
    Newman          MKWSITQLRKYQGKPFEFDQTVSFDNLKESLDLIDLSPITIQGQLTIKSTEVVADIHITG
    USA300_FPR3757  MKWSITQLRKYQGKPFEFDQTVSFDNLKESLDLIDLSPITIQGQLTIKSTEVVADIHITG
                    ************************************************************

    COL             TYTMPCARTLVPVKVPLDVTTTEVFDLEGYNQYNDDQDDVDEHYHIIKDGMVNLQDIVED
    N315            TYTMPCARTLVPVKVPLDVTTTEVFDLEGYNQYNDDQDDVDEHYHIIKDGMVNLQDIVED
    NCTC8325        TYTMPCARTLVPVKVPLDVTTTEVFDLEGYNQYNDDQDDVDEHYHIIKDGMVNLQDIVED
    Newman          TYTMPCARTLVPVKVPLDVTTTEVFDLEGYNQYNDDQDDVDEHYHIIKDGMVNLQDIVED
    USA300_FPR3757  TYTMPCARTLVPVKVPLDVTTTEVFDLEGYNQYNDDQDDVDEHYHIIKDGMVNLQDIVED
                    ************************************************************

    COL             IVIIEKPMRAYSEQSDQMLTVGNGWEVIDEDQLDELAKQQEQDDSESRQVDPRLQKLQQL
    N315            IVIIEKPMRAYSEQSDQMLTVGNGWEVIDEDQLDELAKQQEQDDSESRQVDPRLQKLQQL
    NCTC8325        IVIIEKPMRAYSEQSDQMLTVGNGWEVIDEDQLDELAKQQEQDDSESRQVDPRLQKLQQL
    Newman          IVIIEKPMRAYSEQSDQMLTVGNGWEVIDEDQLDELAKQQEQDDSESRQVDPRLQKLQQL
    USA300_FPR3757  IVIIEKPMRAYSEQSDQMLTVGNGWEVIDEDQLDELAKQQEQDDSESRQVDPRLQKLQQL
                    ************************************************************

    COL             YDKEQ
    N315            YDKEQ
    NCTC8325        YDKEQ
    Newman          YDKEQ
    USA300_FPR3757  YDKEQ
                    *****