From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003356000
  • symbol?: rpmF
  • description?: 50S ribosomal protein L32

      descriptions from strain specific annotations:

    • 50S ribosomal protein L32
    • 50S ribosomalprotein L32p
  • strand?: +
  • coordinates?: 3720696..3720827
  • synteny block?: BlockID0024400
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1137 (rpmF)
    N315:
    SAS033 (rpmF)
    NCTC8325:
    Newman:
    NWMN_0991 (rpmF)
    USA300_FPR3757:
    04-02981:
    SA2981_1084 (rpmF)
    08BA02176:
    C248_1154 (rpmF)
    11819-97:
    MS7_1084 (rpmF)
    71193:
    ST398NM01_1124
    ECT-R 2:
    ECTR2_982 (rpmF)
    ED133:
    SAOV_1069
    ED98:
    SAAV_1094 (rpmF)
    HO 5096 0412:
    SAEMRSA15_09570 (rpmF)
    JH1:
    SaurJH1_1209 (rpmF)
    JH9:
    SaurJH9_1187 (rpmF)
    JKD6008:
    SAA6008_01082 (rpmF)
    JKD6159:
    SAA6159_00982 (rpmF)
    LGA251:
    SARLGA251_10400 (rpmF)
    M013:
    M013TW_1059
    MRSA252:
    SAR1101 (rpmF)
    MSHR1132:
    SAMSHR1132_09740
    MSSA476:
    SAS1062 (rpmF)
    Mu3:
    SAHV_1119 (rpmF)
    Mu50:
    SAV1128 (rpmF)
    MW2:
    MW1010 (rpmF)
    RF122:
    SAB0992 (rpmF)
    ST398:
    SAPIG1124 (rpmF)
    T0131:
    SAT0131_01166 (hysA)
    TCH60:
    HMPREF0772_12105 (rpmF)
    TW20:
    SATW20_11220 (rpmF)
    USA300_TCH1516:
    VC40:
    SAVC_04800 (rpmF)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
    N315            MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
    NCTC8325        MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
    Newman          MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
    USA300_FPR3757  MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
                    *********************************************************