From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003358000
  • symbol?: isdB
  • description?: iron-regulated cell wall-anchored protein SirH

      descriptions from strain specific annotations:

    • iron-regulated cell wall-anchored protein SirH
    • cell wall anchor domain-containing protein
    • LPXTG cell wall surface anchor protein
    • Cell surface receptor IsdB for hemoglobin and hemoglobin-haptoglobin complexes
    • LPXTG-motif cell wall anchor domain-containing protein
    • pseudogene
    • iron transport associated domain-containing protein
    • neurofilament protein
    • iron-regulated heme-iron binding protein IsdB
    • Iron-regulated surface determinant protein B
    • heme uptake protein IsdB
    • cell surface receptor IsdB
  • strand?: -
  • coordinates?: 3723033..3725048
  • synteny block?: BlockID0024410
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1138 (isdB)
    N315:
    SA0976 (isdB)
    NCTC8325:
    Newman:
    NWMN_1040 (isdB)
    USA300_FPR3757:
    04-02981:
    SA2981_1085 (isdB)
    08BA02176:
    C248_1155 (isdB)
    11819-97:
    MS7_1085 (isdB)
    71193:
    ST398NM01_1125
    ECT-R 2:
    ECTR2_983
    ED133:
    SAOV_1125c (isdA)
    ED98:
    SAAV_1095 (isdB)
    HO 5096 0412:
    SAEMRSA15_09580 (isdB)
    JH1:
    SaurJH1_1210
    JH9:
    SaurJH9_1188
    JKD6008:
    SAA6008_01083 (isdB)
    JKD6159:
    SAA6159_00983 (isdB)
    LGA251:
    SARLGA251_10410 (isdB)
    M013:
    M013TW_1060
    MRSA252:
    SAR1102 (isdB)
    MSHR1132:
    SAMSHR1132_09750
    MSSA476:
    SAS1063
    Mu3:
    SAHV_1120
    Mu50:
    SAV1129
    MW2:
    MW1011 (isdB)
    RF122:
    SAB0993c (isdA)
    ST398:
    SAPIG1125
    T0131:
    SAT0131_01167
    TCH60:
    HMPREF0772_12104 (isdB)
    TW20:
    SATW20_11230 (isdB)
    USA300_TCH1516:
    VC40:
    SAVC_04805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKQQKEFKSFYSIRKSSLGVASVAISTLLLLMSNGEAQAAAEETGGTNTEAQPKTEAVA
    N315            MNKQQKEFKSFYSIRKSSLGVASVAISTLLLLMSNGEAQAAAEETGGTNTEAQPKTEAVA
    NCTC8325        MNKQQKEFKSFYSIRKSSLGVASVAISTLLLLMSNGEAQAAAEETGGTNTEAQPKTEAVA
    Newman          MNKQQKEFKSFYSIRKSSLGVASVAISTLLLLMSNGEAQAAAEETGGTNTEAQPKTEAVA
    USA300_FPR3757  MNKQQKEFKSFYSIRKSSLGVASVAISTLLLLMSNGEAQAAAEETGGTNTEAQPKTEAVA
                    ************************************************************

    COL             SPTTTSEKAPETKPVANAVSVSNKEVEAPTSETKEAKEVKEVKAPKETKEVKPAAKATNN
    N315            SPTTTSEKAPETKPVANAVSVSNKEVEAPTSETKEAKEVKEVKAPKETKAVKPAAKATNN
    NCTC8325        SPTTTSEKAPETKPVANAVSVSNKEVEAPTSETKEAKEVKEVKAPKETKEVKPAAKATNN
    Newman          SPTTTSEKAPETKPVANAVSVSNKEVEAPTSETKEAKEVKEVKAPKETKEVKPAAKATNN
    USA300_FPR3757  SPTTTSEKAPETKPVANAVSVSNKEVEAPTSETKEAKEVKEVKAPKETKEVKPAAKATNN
                    ************************************************* **********

    COL             TYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTD
    N315            TYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKENGEQQFYHYASSVKPARVIFTD
    NCTC8325        TYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTD
    Newman          TYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTD
    USA300_FPR3757  TYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTD
                    *************************************::* *******************

    COL             SKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSST
    N315            SKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSST
    NCTC8325        SKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSST
    Newman          SKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSST
    USA300_FPR3757  SKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSST
                    ************************************************************

    COL             HFNNKEEKYDYTLMEFAQPIYNSADKFKTEEDYKAEKLLAPYKKAKTLERQVYELNKIQD
    N315            HFNNKEEKYDYTLMEFAQPIYNSADKFKTEEDYKAEKLLAPYKKAKTLERQVYELNKIQD
    NCTC8325        HFNNKEEKYDYTLMEFAQPIYNSADKFKTEEDYKAEKLLAPYKKAKTLERQVYELNKIQD
    Newman          HFNNKEEKYDYTLMEFAQPIYNSADKFKTEEDYKAEKLLAPYKKAKTLERQVYELNKIQD
    USA300_FPR3757  HFNNKEEKYDYTLMEFAQPIYNSADKFKTEEDYKAEKLLAPYKKAKTLERQVYELNKIQD
                    ************************************************************

    COL             KLPEKLKAEYKKKLEDTKKALDEQVKSAITEFQNVQPTNEKMTDLQDTKYVVYESVENNE
    N315            KLPEKLKAEYKKKLEDTKKALDEQVKSAITEFQNVQPTNEKMTDLQDTKYVVYESVENNE
    NCTC8325        KLPEKLKAEYKKKLEDTKKALDEQVKSAITEFQNVQPTNEKMTDLQDTKYVVYESVENNE
    Newman          KLPEKLKAEYKKKLEDTKKALDEQVKSAITEFQNVQPTNEKMTDLQDTKYVVYESVENNE
    USA300_FPR3757  KLPEKLKAEYKKKLEDTKKALDEQVKSAITEFQNVQPTNEKMTDLQDTKYVVYESVENNE
                    ************************************************************

    COL             SMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPY
    N315            SMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPY
    NCTC8325        SMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPY
    Newman          SMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPY
    USA300_FPR3757  SMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPY
                    ************************************************************

    COL             VEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFTKANTDKSNKKEQQDNSAKKEATPAT
    N315            VEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFTKANTDKSNKKEQQDNSAKKEATPAT
    NCTC8325        VEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFTKANTDKSNKKEQQDNSAKKEATPAT
    Newman          VEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFTKANTDKSNKKEQQDNSAKKEATPAT
    USA300_FPR3757  VEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFTKANTDKSNKKEQQDNSAKKEATPAT
                    ************************************************************

    COL             PSKPTPSPVEKESQKQDSQKDDNKQLPSVEKENDASSESGKDKTPATKPTKGEVESSSTT
    N315            PSKPTPSPVEKESQKQDSQKDDNKQLPSVEKENDASSESGKDKTPATKPTKGEVESSSTT
    NCTC8325        PSKPTPSPVEKESQKQDSQKDDNKQLPSVEKENDASSESGKDKTPATKPTKGEVESSSTT
    Newman          PSKPTPSPVEKESQKQDSQKDDNKQLPSVEKENDASSESGKDKTPATKPTKGEVESSSTT
    USA300_FPR3757  PSKPTPSPVEKESQKQDSQKDDNKQLPSVEKENDASSESGKDKTPATKPTKGEVESSSTT
                    ************************************************************

    COL             PTKVVSTTQNVAKPTTASSKTTKDVVQTSAGSSEAKDSAPLQKANIKNTNDGHTQSQNNK
    N315            PTKVVSTTQNVAKPTTASSKTTKDVVQTSAGSSEAKDSAPLQKANIKNTNDGHTQSQNNK
    NCTC8325        PTKVVSTTQNVAKPTTASSKTTKDVVQTSAGSSEAKDSAPLQKANIKNTNDGHTQSQNNK
    Newman          PTKVVSTTQNVAKPTTASSKTTKDVVQTSAGSSEAKDSAPLQKANIKNTNDGHTQSQNNK
    USA300_FPR3757  PTKVVSTTQNVAKPTTASSKTTKDVVQTSAGSSEAKDSAPLQKANIKNTNDGHTQSQNNK
                    ************************************************************

    COL             NTQENKAKSLPQTGEESNKDMTLPLMALLALSSIVAFVLPRKRKN
    N315            NTQENKAKSLPQTGEESNKDMTLPLMALLALSSIVAFVLPRKRKN
    NCTC8325        NTQENKAKSLPQTGEESNKDMTLPLMALLALSSIVAFVLPRKRKN
    Newman          NTQENKAKSLPQTGEESNKDMTLPLMALLALSSIVAFVLPRKRKN
    USA300_FPR3757  NTQENKAKSLPQTGEESNKDMTLPLMALLALSSIVAFVLPRKRKN
                    *********************************************