From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003362000
  • symbol?: isdD
  • description?: Heme transporter IsdDEF, membrane component IsdD

      descriptions from strain specific annotations:

    • Heme transporter IsdDEF, membrane component IsdD
    • heme ABC transporter, membrane component IsdD
    • iron complex transport system permease
    • iron-regulated protein
    • Iron-transporting membrane protein
  • strand?: +
  • coordinates?: 3727959..3729038
  • synteny block?: BlockID0024450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1142 (isdD)
    N315:
    SA0979 (isdD)
    NCTC8325:
    Newman:
    NWMN_1043 (isdD)
    USA300_FPR3757:
    04-02981:
    SA2981_1088 (isdD)
    08BA02176:
    C248_1158 (isdD)
    11819-97:
    MS7_1088 (isdD)
    71193:
    ST398NM01_1128
    ECT-R 2:
    ECTR2_986
    ED133:
    SAOV_1128 (isdD)
    ED98:
    SAAV_1098 (isdD)
    HO 5096 0412:
    SAEMRSA15_09610 (isdD)
    JH1:
    SaurJH1_1213
    JH9:
    SaurJH9_1191
    JKD6008:
    SAA6008_01086 (isdD)
    JKD6159:
    SAA6159_00986 (isdD)
    LGA251:
    SARLGA251_10440 (isdD)
    M013:
    M013TW_1065
    MRSA252:
    SAR1105 (isdD)
    MSHR1132:
    SAMSHR1132_09780
    MSSA476:
    SAS1066
    Mu3:
    SAHV_1123
    Mu50:
    SAV1132
    MW2:
    MW1014 (isdD)
    RF122:
    SAB0996 (isdD)
    ST398:
    SAPIG1128
    T0131:
    SAT0131_01171
    TCH60:
    HMPREF0772_12101 (isdD)
    TW20:
    SATW20_11260 (isdD)
    USA300_TCH1516:
    USA300HOU_1066
    VC40:
    SAVC_04820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDE
    N315            MRNVKQIATKSIIAIISLCILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDE
    NCTC8325        MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDE
    Newman          MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDE
    USA300_FPR3757  MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDE
                    ****************** *****************************************

    COL             KIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQN
    N315            KIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQN
    NCTC8325        KIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQN
    Newman          KIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQN
    USA300_FPR3757  KIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQN
                    ************************************************************

    COL             DKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQ
    N315            DKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQ
    NCTC8325        DKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQ
    Newman          DKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQ
    USA300_FPR3757  DKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQ
                    ************************************************************

    COL             HDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQ
    N315            HDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQ
    NCTC8325        HDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQ
    Newman          HDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQ
    USA300_FPR3757  HDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQ
                    ************************************************************

    COL             QDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALP
    N315            QDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALP
    NCTC8325        QDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALP
    Newman          QDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALP
    USA300_FPR3757  QDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALP
                    ************************************************************

    COL             AFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV
    N315            AFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV
    NCTC8325        AFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV
    Newman          AFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV
    USA300_FPR3757  AFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV
                    **********************************************************