From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003374000
  • symbol?: pheS
  • description?: phenylalanyl-tRNA synthetase subunit alpha

      descriptions from strain specific annotations:

    • phenylalanyl-tRNA synthetase subunit alpha
    • phenylalanine--tRNA ligase subunit alpha
    • putative phenylalanyl-tRNA synthetase alphachain
    • phenylalanine--tRNA ligase, alpha subunit
    • phenylalanyl-tRNA synthetase, alpha subunit
    • Phenylalanyl-tRNA synthetase alpha chain
  • strand?: +
  • coordinates?: 3735685..3736743
  • synteny block?: BlockID0024570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1148 (pheS)
    N315:
    SA0985 (pheS)
    NCTC8325:
    Newman:
    NWMN_1049 (pheS)
    USA300_FPR3757:
    04-02981:
    SA2981_1094 (pheS)
    08BA02176:
    C248_1165 (pheS)
    11819-97:
    MS7_1094 (pheS)
    71193:
    ST398NM01_1134
    ECT-R 2:
    ECTR2_992 (pheS)
    ED133:
    SAOV_1134 (pheS)
    ED98:
    SAAV_1105 (pheS)
    HO 5096 0412:
    SAEMRSA15_09680 (pheS)
    JH1:
    SaurJH1_1219 (pheS)
    JH9:
    SaurJH9_1197 (pheS)
    JKD6008:
    SAA6008_01092 (pheS)
    JKD6159:
    SAA6159_00992 (pheS)
    LGA251:
    SARLGA251_10500 (pheS)
    M013:
    M013TW_1071
    MRSA252:
    SAR1111 (pheS)
    MSHR1132:
    SAMSHR1132_09840
    MSSA476:
    SAS1072 (pheS)
    Mu3:
    SAHV_1129 (pheS)
    Mu50:
    SAV1138 (pheS)
    MW2:
    MW1021 (pheS)
    RF122:
    SAB1002 (pheS)
    ST398:
    SAPIG1134 (pheS)
    T0131:
    SAT0131_01179
    TCH60:
    HMPREF0772_12095 (pheS)
    TW20:
    SATW20_11320 (pheS)
    USA300_TCH1516:
    USA300HOU_1073 (pheS)
    VC40:
    SAVC_04855 (pheS)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEQQTMSELKQQALVDINEANDERALQEVKVKYLGKKGSVSGLMKLMKDLPNEDKPAFG
    N315            MSEQQTMSELKQQALVDINEANDERALQEVKVKYLGKKGSVSGLMKLMKDLPNEEKPAFG
    NCTC8325        MSEQQTMSELKQQALVDINEANDERALQEVKVKYLGKKGSVSGLMKLMKDLPNEDKPAFG
    Newman          MSEQQTMSELKQQALVDINEANDERALQEVKVKYLGKKGSVSGLMKLMKDLPNEDKPAFG
    USA300_FPR3757  MSEQQTMSELKQQALVDINEANDERALQEVKVKYLGKKGSVSGLMKLMKDLPNEDKPAFG
                    ******************************************************:*****

    COL             QKVNELRQTIQNELDERQQMLVKEKLNKQLAEETIDVSLPGRHIEIGSKHPLTRTIEEIE
    N315            QKVNELRQTIQNELDERQQMLVKEKLNKQLAEETIDVSLPGRHIEIGSKHPLTRTIEEIE
    NCTC8325        QKVNELRQTIQNELDERQQMLVKEKLNKQLAEETIDVSLPGRHIEIGSKHPLTRTIEEIE
    Newman          QKVNELRQTIQNELDERQQMLVKEKLNKQLAEETIDVSLPGRHIEIGSKHPLTRTIEEIE
    USA300_FPR3757  QKVNELRQTIQNELDERQQMLVKEKLNKQLAEETIDVSLPGRHIEIGSKHPLTRTIEEIE
                    ************************************************************

    COL             DLFLGLGYEIVNGYEVEQDHYNFEMLNLPKSHPARDMQDSFYITDEILLRTHTSPVQART
    N315            DLFLGLGYEIVNGYEVEQDHYNFEMLNLPKSHPARDMQDSFYITDEILLRTHTSPVQART
    NCTC8325        DLFLGLGYEIVNGYEVEQDHYNFEMLNLPKSHPARDMQDSFYITDEILLRTHTSPVQART
    Newman          DLFLGLGYEIVNGYEVEQDHYNFEMLNLPKSHPARDMQDSFYITDEILLRTHTSPVQART
    USA300_FPR3757  DLFLGLGYEIVNGYEVEQDHYNFEMLNLPKSHPARDMQDSFYITDEILLRTHTSPVQART
                    ************************************************************

    COL             MESRHGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNVKMSDLKGTLELLAKKL
    N315            MESRHGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNVKMSDLKGTLELLAKKL
    NCTC8325        MESRHGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNVKMSDLKGTLELLAKKL
    Newman          MESRHGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNVKMSDLKGTLELLAKKL
    USA300_FPR3757  MESRHGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNVKMSDLKGTLELLAKKL
                    ************************************************************

    COL             FGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMA
    N315            FGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMA
    NCTC8325        FGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMA
    Newman          FGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMA
    USA300_FPR3757  FGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMA
                    ************************************************************

    COL             GFDSSEYSGFAFGMGPDRIAMLKYGIEDIRHFYTNDVRFLDQFKAVEDRGDM
    N315            GFDSSEYSGFAFGMGPDRIAMLKYGIEDIRHFYTNDVRFLDQFKAVEDRGDM
    NCTC8325        GFDSSEYSGFAFGMGPDRIAMLKYGIEDIRHFYTNDVRFLDQFKAVEDRGDM
    Newman          GFDSSEYSGFAFGMGPDRIAMLKYGIEDIRHFYTNDVRFLDQFKAVEDRGDM
    USA300_FPR3757  GFDSSEYSGFAFGMGPDRIAMLKYGIEDIRHFYTNDVRFLDQFKAVEDRGDM
                    ****************************************************