From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003375000
  • symbol?: pheT
  • description?: phenylalanyl-tRNA synthetase subunit beta

      descriptions from strain specific annotations:

    • phenylalanyl-tRNA synthetase subunit beta
    • Phenylalanyl-tRNA synthetase beta chain
    • putative phenylalanyl-tRNA synthetase betachain
    • phenylalanine--tRNA ligase, beta subunit
    • phenylalanyl-tRNA synthetase, beta subunit
  • strand?: +
  • coordinates?: 3736743..3739145
  • synteny block?: BlockID0024580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1149 (pheT)
    N315:
    SA0986 (pheT)
    NCTC8325:
    Newman:
    NWMN_1050 (pheT)
    USA300_FPR3757:
    04-02981:
    SA2981_1095 (pheT)
    08BA02176:
    C248_1166 (pheT)
    11819-97:
    MS7_1095 (pheT)
    71193:
    ST398NM01_1135
    ECT-R 2:
    ECTR2_993 (pheT)
    ED133:
    SAOV_1135 (pheT)
    ED98:
    SAAV_1106 (pheT)
    HO 5096 0412:
    SAEMRSA15_09690 (pheT)
    JH1:
    SaurJH1_1220 (pheT)
    JH9:
    SaurJH9_1198 (pheT)
    JKD6008:
    SAA6008_01093 (pheT)
    JKD6159:
    SAA6159_00993 (pheT)
    LGA251:
    SARLGA251_10510 (pheT)
    M013:
    M013TW_1072
    MRSA252:
    SAR1112 (pheT)
    MSHR1132:
    SAMSHR1132_09850
    MSSA476:
    SAS1073 (pheT)
    Mu3:
    SAHV_1130 (pheT)
    Mu50:
    SAV1139 (pheT)
    MW2:
    MW1022 (pheT)
    RF122:
    SAB1003 (pheT)
    ST398:
    SAPIG1135 (pheT)
    T0131:
    SAT0131_01180
    TCH60:
    HMPREF0772_12094 (pheT)
    TW20:
    SATW20_11330 (pheT)
    USA300_TCH1516:
    USA300HOU_1074 (pheT)
    VC40:
    SAVC_04860 (pheT)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLISNEWLKEYVTIDDSVSNLAERITRTGIEVDDLIDYTKDIKNLVVGFVKSKEKHPDAD
    N315            MLISNEWLKEYVTIDDSVSDLAERITRTGIEVDDLIDYTKDIKNLVVGFVKSKEKHPDAD
    NCTC8325        MLISNEWLKEYVTIDDSVSNLAERITRTGIEVDDLIDYTKDIKNLVVGFVKSKEKHPDAD
    Newman          MLISNEWLKEYVTIDDSVSNLAERITRTGIEVDDLIDYTKDIKNLVVGFVKSKEKHPDAD
    USA300_FPR3757  MLISNEWLKEYVTIDDSVSNLAERITRTGIEVDDLIDYTKDIKNLVVGFVKSKEKHPDAD
                    *******************:****************************************

    COL             KLNVCQVDIGEDEPVQIVCGAPNVDAGQYVIVAKVGGRLPGGIKIKRAKLRGERSEGMIC
    N315            KLNVCQVDIGEDEPVQIVCGAPNVDAGQYVIVAKVGGRLPGGIKIKRAKLRGERSEGMIC
    NCTC8325        KLNVCQVDIGEDEPVQIVCGAPNVDAGQYVIVAKVGGRLPGGIKIKRAKLRGERSEGMIC
    Newman          KLNVCQVDIGEDEPVQIVCGAPNVDAGQYVIVAKVGGRLPGGIKIKRAKLRGERSEGMIC
    USA300_FPR3757  KLNVCQVDIGEDEPVQIVCGAPNVDAGQYVIVAKVGGRLPGGIKIKRAKLRGERSEGMIC
                    ************************************************************

    COL             SLQEIGISSNYIPKSFESGIYVFSEAQVPGTDALQALYLDDQVMEFDLTPNRADALSMIG
    N315            SLQEIGISSNYIPKSFESGIYVFSESQVPGTDALQALYLDDQVMEFDLTPNRADALSMIG
    NCTC8325        SLQEIGISSNYIPKSFESGIYVFSEAQVPGTDALQALYLDDQVMEFDLTPNRADALSMIG
    Newman          SLQEIGISSNYIPKSFESGIYVFSEAQVPGTDALQALYLDDQVMEFDLTPNRADALSMIG
    USA300_FPR3757  SLQEIGISSNYIPKSFESGIYVFSEAQVPGTDALQALYLDDQVMEFDLTPNRADALSMIG
                    *************************:**********************************

    COL             TAYEVAALYNTKMTKPETTSNELDLSANDELTVTIENEDKVPYYSARVVHDVTIEPSPIW
    N315            TAYEVAALYNTKMTKPETTSNELELSANDELTVTIENEDKVPYYSARVVHDVTIEPSPIW
    NCTC8325        TAYEVAALYNTKMTKPETTSNELDLSANDELTVTIENEDKVPYYSARVVHDVTIEPSPIW
    Newman          TAYEVAALYNTKMTKPETTSNELDLSANDELTVTIENEDKVPYYSARVVHDVTIEPSPIW
    USA300_FPR3757  TAYEVAALYNTKMTKPETTSNELDLSANDELTVTIENEDKVPYYSARVVHDVTIEPSPIW
                    ***********************:************************************

    COL             MQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDAIGSQQIVVRQANEGEKMTTLDD
    N315            MQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDAIGSQQIVVRQANEGEKMTTLDD
    NCTC8325        MQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDAIGSQQIVVRQANEGEKMTTLDD
    Newman          MQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDAIGSQQIVVRQANEGEKMTTLDD
    USA300_FPR3757  MQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDAIGSQQIVVRQANEGEKMTTLDD
                    ************************************************************

    COL             TERELLTSDIVITNGQTPIALAGVMGGDFSEVKEQTSNIVIEGAIFDPVSIRHTSRRLNL
    N315            TERELLTSDIVITNGQTPIALAGVMGGDFSEVKEQTSNIVIEGAIFDPVSIRHTSRRLNL
    NCTC8325        TERELLTSDIVITNGQTPIALAGVMGGDFSEVKEQTSNIVIEGAIFDPVSIRHTSRRLNL
    Newman          TERELLTSDIVITNGQTPIALAGVMGGDFSEVKEQTSNIVIEGAIFDPVSIRHTSRRLNL
    USA300_FPR3757  TERELLTSDIVITNGQTPIALAGVMGGDFSEVKEQTSNIVIEGAIFDPVSIRHTSRRLNL
                    ************************************************************

    COL             RSESSSRFEKGIATEFVDEAVDRACYLLQTYANGKVLKDRVSSGELGAFITPIDITADKI
    N315            RSESSSRFEKGIATEFVDEAVDRACYLLQTYANGKVLKDRVSSGELGAFITPIDITADKI
    NCTC8325        RSESSSRFEKGIATEFVDEAVDRACYLLQTYANGKVLKDRVSSGELGAFITPIDITADKI
    Newman          RSESSSRFEKGIATEFVDEAVDRACYLLQTYANGKVLKDRVSSGELGAFITPIDITADKI
    USA300_FPR3757  RSESSSRFEKGIATEFVDEAVDRACYLLQTYANGKVLKDRVSSGELGAFITPIDITADKI
                    ************************************************************

    COL             NRTIGFDLSQNDIVTIFNQLGFDTEINDDVITVLVPSRRKDITIKEDLIEEVARIYGYDD
    N315            NRTIGFDLSQNDIVTIFNQLGFDTEINDDVITVLVPSRRKDITIKEDLIEEVARIYGYDD
    NCTC8325        NRTIGFDLSQNDIVTIFNQLGFDTEINDDVITVLVPSRRKDITIKEDLIEEVARIYGYDD
    Newman          NRTIGFDLSQNDIVTIFNQLGFDTEINDDVITVLVPSRRKDITIKEDLIEEVARIYGYDD
    USA300_FPR3757  NRTIGFDLSQNDIVTIFNQLGFDTEINDDVITVLVPSRRKDITIKEDLIEEVARIYGYDD
                    ************************************************************

    COL             IPSTLPVFDKVTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKEDATAFSMQQRQTI
    N315            IPSTLPVFDKVTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKEDATAFSMQQRQTI
    NCTC8325        IPSTLPVFDKVTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKEDATAFSMQQRQTI
    Newman          IPSTLPVFDKVTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKEDATAFSMQQRQTI
    USA300_FPR3757  IPSTLPVFDKVTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKEDATAFSMQQRQTI
                    ************************************************************

    COL             DLLMPMSEAHASLRQSLLPHLIEAASYNVARKNKDVKLFEIGNVFFANGEGELPDQVEYL
    N315            DLLMPMSEAHASLRQSLLPHLIEAASYNVARKNKDVKLFEIGNVFFANGEGELPDQVEYL
    NCTC8325        DLLMPMSEAHASLRQSLLPHLIEAASYNVARKNKDVKLFEIGNVFFANGEGELPDQVEYL
    Newman          DLLMPMSEAHASLRQSLLPHLIEAASYNVARKNKDVKLFEIGNVFFANGEGELPDQVEYL
    USA300_FPR3757  DLLMPMSEAHASLRQSLLPHLIEAASYNVARKNKDVKLFEIGNVFFANGEGELPDQVEYL
                    ************************************************************

    COL             SGILTGDYVVNQWQGKKETVDFYLAKGVVDRVSEKLNLEFSYRRADIDGLHPGRTAEILL
    N315            SGILTGDYVVNQWQGKKETVDFYLAKGVVDRVSEKLNLEFSYRRADIDGLHPGRTAEILL
    NCTC8325        SGILTGDYVVNQWQGKKETVDFYLAKGVVDRVSEKLNLEFSYRRADIDGLHPGRTAEILL
    Newman          SGILTGDYVVNQWQGKKETVDFYLAKGVVDRVSEKLNLEFSYRRADIDGLHPGRTAEILL
    USA300_FPR3757  SGILTGDYVVNQWQDKKETVDFYLAKGVVDRVSEKLNLEFSYRRADIDGLHPGRTAEILL
                    **************.*********************************************

    COL             ENKVVGFIGELHPILAADNDLKRTYVFELNFDALMAVSVGYINYQPIPRFPGMSRDIALE
    N315            ENKVVGFIGELHPTLAADNDLKRTYVFELNFDALMAVSVGYINYQPIPRFPGMSRDIALE
    NCTC8325        ENKVVGFIGELHPILAADNDLKRTYVFELNFDALMAVSVGYINYQPIPRFPGMSRDIALE
    Newman          ENKVVGFIGELHPILAADNDLKRTYVFELNFDALMAVSVGYINYQPIPRFPGMSRDIALE
    USA300_FPR3757  ENKVVGFIGELHPILAADNDLKRTYVFELNFDALMAVSVGYINYQPIPRFPGMSRDIALE
                    ************* **********************************************

    COL             VDQNIPAADLLSTIHAHGGNILKDTLVFDVYQGEHLEKGKKSIAIRLNYLDTEETLTDER
    N315            VDQNIPAADLLSTIHAHGGNILKDTLVFDVYQGEHLEKGKKSIAIRLNYLDTEETLTDER
    NCTC8325        VDQNIPAADLLSTIHAHGGNILKDTLVFDVYQGEHLEKGKKSIAIRLNYLDTEETLTDER
    Newman          VDQNIPAADLLSTIHAHGGNILKDTLVFDVYQGEHLEKGKKSIAIRLNYLDTEETLTDER
    USA300_FPR3757  VDQNIPAADLLSTIHAHGGNILKDTLVFDVYQGEHLEKGKKSIAIRLNYLDTEETLTDER
                    ************************************************************

    COL             VSKVQAEIEAALIEQGAVIR
    N315            VSKVQAEIEAALIEQGAVIR
    NCTC8325        VSKVQAEIEAALIEQGAVIR
    Newman          VSKVQAEIEAALIEQGAVIR
    USA300_FPR3757  VSKVQAEIEAALIEQGAVIR
                    ********************