From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003380000
  • symbol?:
  • description?: colicin V production protein CvpA

      descriptions from strain specific annotations:

    • colicin V production protein CvpA
    • Colicin V production protein
    • colicin V production family protein
    • CvpA family protein
    • membrane protein
  • strand?: +
  • coordinates?: 3741585..3742106
  • synteny block?: BlockID0024630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1098
    08BA02176:
    C248_1169
    11819-97:
    MS7_1099
    71193:
    ST398NM01_1138
    ECT-R 2:
    ECTR2_996
    ED133:
    SAOV_1139
    ED98:
    SAAV_1109
    HO 5096 0412:
    SAEMRSA15_09720
    JH1:
    SaurJH1_1223
    JH9:
    SaurJH9_1201
    JKD6008:
    SAA6008_01096
    JKD6159:
    SAA6159_00996
    LGA251:
    SARLGA251_10540
    M013:
    M013TW_1075
    MRSA252:
    SAR1115
    MSHR1132:
    SAMSHR1132_09880
    MSSA476:
    SAS1076
    Mu3:
    SAHV_1133
    Mu50:
    SAV1142
    MW2:
    MW1025
    RF122:
    SAB1006
    ST398:
    SAPIG1138 (cvpA)
    T0131:
    SAT0131_01184 (rpsI)
    TCH60:
    HMPREF0772_12091 (cvpA)
    TW20:
    SATW20_11360
    USA300_TCH1516:
    USA300HOU_1077
    VC40:
    SAVC_04875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVIDFIIIIFFVYFVIVGFRRGFWLSMIHLSATIVSLWIASQFYKSIVERLIVFIPYPKT
    N315            MVIDFIIIIFFVYFVIVGFRRGFWLSMIHLSATIVSLWIASQFYKSIVERLIVFIPYPKT
    NCTC8325        MVIDFIIIIFFVYFVIVGFRRGFWLSMIHLSATIVSLWIASQFYKSIVERLIVFIPYPKT
    Newman          MVIDFIIIIFFVYFVIVGFRRGFWLSMIHLSATIVSLWIASQFYKSIVERLIVFIPYPKT
    USA300_FPR3757  MVIDFIIIIFFVYFVIVGFRRGFWLSMIHLSATIVSLWIASQFYKSIVERLIVFIPYPKT
                    ************************************************************

    COL             TAFNTTFAFHFNHLQNRFEAIVAFLMITLFCKFILYLIIVTFDKIIAYQNIHIFSRAMGM
    N315            TAFNTTFAFHFNHLQNRFEAIVAFLMITLFCKFILYLIIVTFDKIIAYQNIHIFSRAMGM
    NCTC8325        TAFNTTFAFHFNHLQNRFEAIVAFLMITLFCKFILYLIIVTFDKIIAYQNIHIFSRAMGM
    Newman          TAFNTTFAFHFNHLQNRFEAIVAFLMITLFCKFILYLIIVTFDKIIAYQNIHIFSRAMGM
    USA300_FPR3757  TAFNTTFAFHFNHLQNRFEAIVAFLMITLFCKFILYLIIVTFDKIIAYQNIHIFSRAMGM
                    ************************************************************

    COL             IVGVFMTIIVLHFTLYLLALYPNEALQHQLKISIVSHSLIFHIPYLSAFTINL
    N315            IVGVFMTIIVLHFTLYLLALYPNEALQHQLKISIVSHSLIFHIPYLSAFTINL
    NCTC8325        IVGVFMTIIVLHFTLYLLALYPNEALQHQLKISIVSHSLIFHIPYLSAFTINL
    Newman          IVGVFMTIIVLHFTLYLLALYPNEALQHQLKISIVSHSLIFHIPYLSAFTINL
    USA300_FPR3757  IVGVFMTIIVLHFTLYLLALYPNEALQHQLKISIVSHSLIFHIPYLSAFTINL
                    *****************************************************