From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003381000
  • symbol?: polX
  • description?: DNA polymerase/3'-5' exonuclease PolX

      descriptions from strain specific annotations:

    • DNA polymerase/3'-5' exonuclease PolX
    • DNA polymerase X family
    • bifunctional DNA polymerase / phosphoesterase
    • DNA-dependent DNA polymerase beta chain
    • DNA-dependent DNA polymerase family X
    • DNA polymerase X family protein
    • PHP domain-containing protein
  • strand?: +
  • coordinates?: 3742179..3743891
  • synteny block?: BlockID0024640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1055 (rpoD)
    USA300_FPR3757:
    04-02981:
    SA2981_1099
    08BA02176:
    C248_1170
    11819-97:
    MS7_1100 (polX)
    71193:
    ST398NM01_1139
    ECT-R 2:
    ECTR2_997
    ED133:
    SAOV_1140
    ED98:
    SAAV_1110
    HO 5096 0412:
    SAEMRSA15_09730
    JH1:
    SaurJH1_1224
    JH9:
    SaurJH9_1202
    JKD6008:
    SAA6008_01097
    JKD6159:
    SAA6159_00997
    LGA251:
    SARLGA251_10550
    M013:
    M013TW_1076
    MRSA252:
    SAR1116
    MSHR1132:
    SAMSHR1132_09890
    MSSA476:
    SAS1077
    Mu3:
    SAHV_1134
    Mu50:
    SAV1143
    MW2:
    MW1026
    RF122:
    SAB1007
    ST398:
    SAPIG1139
    T0131:
    SAT0131_01185 (rplM)
    TCH60:
    HMPREF0772_12090
    TW20:
    SATW20_11370
    USA300_TCH1516:
    USA300HOU_1078 (dinB)
    VC40:
    SAVC_04880

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKKDVIKLLEQIATYMELKGENTFKISAYRKAAQSLELDERPLDEISDVTELKGIGKGV
    N315            MTKKDVIKLLEQIATYMELKGENTFKISAYRKAAQSLELDERPLDEISDVTELKGIGKGV
    NCTC8325        MTKKDVIKLLEQIATYMELKGENTFKISAYRKAAQSLELDERPLDEISDVTELKGIGKGV
    Newman          MTKKDVIKLLEQIATYMELKGENTFKISAYRKAAQSLELDERPLDEISDVTELKGIGKGV
    USA300_FPR3757  MTKKDVIKLLEQIATYMELKGENTFKISAYRKAAQSLELDERPLDEISDVTELKGIGKGV
                    ************************************************************

    COL             AEVINDYRETGESQYLQQLQEEVPEGLIPLLKIQGLGSKKIAKLYKELNIVDKASLQVAC
    N315            AEVINDYRETGESQYLQQLQEEVPEGLIPLLKIQGLGSKKIAKLYKELNIVDKASLQVAC
    NCTC8325        AEVINDYRETGESQYLQQLQEEVPEGLIPLLKIQGLGSKKIAKLYKELNIVDKASLQVAC
    Newman          AEVINDYRETGESQYLQQLQEEVPEGLIPLLKIQGLGSKKIAKLYKELNIVDKASLQVAC
    USA300_FPR3757  AEVINDYRETGESQYLQQLQEEVPEGLIPLLKIQGLGSKKIAKLYKELNIVDKASLQVAC
                    ************************************************************

    COL             ENGKVSELSGFAKKTEQNILEAVKQLGAKKDRYPIDQMRRLNQEIIDYIDTLNYIDQYSS
    N315            ENGKVSELSGFAKKTEQNILEAVKQLGAKKDRYPIDQMRRLNQEIIDYIDTLNYIDQYSS
    NCTC8325        ENGKVSELSGFAKKTEQNILEAVKQLGAKKDRYPIDQMRRLNQEIIDYIDTLNYIDQYSS
    Newman          ENGKVSELSGFAKKTEQNILEAVKQLGAKKDRYPIDQMRRLNQEIIDYIDTLNYIDQYSS
    USA300_FPR3757  ENGKVSELSGFAKKTEQNILEAVKQLGAKKDRYPIDQMRRLNQEIIDYIDTLNYIDQYSS
                    ************************************************************

    COL             AGSFRRFKEMSKDLDFIISTDNPKAVQQQLLNIPNKVKEVAVGNTKVSLELAYDDETIGV
    N315            AGSFRRFKEMSKDLDFIISTDNPKAVQQQLLNIPNKVKEVAVGNTKVSLELAYDDETIGV
    NCTC8325        AGSFRRFKEMSKDLDFIISTDNPKAVQQQLLNIPNKVKEVAVGNTKVSLELAYDDETIGV
    Newman          AGSFRRFKEMSKDLDFIISTDNPKAVQQQLLNIPNKVKEVAVGNTKVSLELAYDDETIGV
    USA300_FPR3757  AGSFRRFKEMSKDLDFIISTDNPKAVQQQLLNIPNKVKEVAVGNTKVSLELAYDDETIGV
                    ************************************************************

    COL             DFRLIEPSAFYHTLQHFTGSKEHNIRIRQLAKARDEKVSEYGIEQADGTLIQYDSEAKIY
    N315            DFRLIEPRAFYHTLQHFTGSKEHNIRIRQLAKARDEKVSEYGIEQADGTLIQYDSEAKIY
    NCTC8325        DFRLIEPSAFYHTLQHFTGSKEHNIRIRQLAKARDEKVSEYGIEQADGTLIQYDSEAKIY
    Newman          DFRLIEPSAFYHTLQHFTGSKEHNIRIRQLAKARDEKVSEYGIEQADGTLIQYDSEAKIY
    USA300_FPR3757  DFRLIEPSAFYHTLQHFTGSKEHNIRIRQLAKARDEKVSEYGIEQADGTLIQYDSEAKIY
                    ******* ****************************************************

    COL             EHFNVNFIPPAMREDGSEFDKDLSNIITIDDINGDIHMHTTYSDGAFSIRDMVEANIAKG
    N315            EHFNVNFIPPAMREDGSEFDKDLSNIITLDDINGDIHMHTTYSDGAFSIRDMVEANIAKG
    NCTC8325        EHFNVNFIPPAMREDGSEFDKDLSNIITIDDINGDIHMHTTYSDGAFSIRDMVEANIAKG
    Newman          EHFNVNFIPPAMREDGSEFDKDLSNIITIDDINGDIHMHTTYSDGAFSIRDMVEANIAKG
    USA300_FPR3757  EHFNVNFIPPAMREDGSEFDKDLSNIITIDDINGDIHMHTTYSDGAFSIRDMVEANIAKG
                    ****************************:*******************************

    COL             YKFMVITDHSQSLRVANGLQVERLLRQNEEIKALDKEYSEIDIYSGTEMDILPDGSLDYD
    N315            YKFMVITDHSQSLRVANGLQVERLLRQNEEIKALDKEYSEIDIYSGTEMDILPDGSLDYD
    NCTC8325        YKFMVITDHSQSLRVANGLQVERLLRQNEEIKALDKEYSEIDIYSGTEMDILPDGSLDYD
    Newman          YKFMVITDHSQSLRVANGLQVERLLRQNEEIKALDKEYSEIDIYSGTEMDILPDGSLDYD
    USA300_FPR3757  YKFMVITDHSQSLRVANGLQVERLLRQNEEIKALDKEYSEIDIYSGTEMDILPDGSLDYD
                    ************************************************************

    COL             DEILAQLDYVIGAIHQSFNQSEEQIMERLANACRNPYVRHIAHPTGRIIGRRDGYKPNIE
    N315            DEILAQLDYVIGAIHQSFNQSEEQIMERLANACRNPYVRHIAHPTGRIIGRRDGYKPNIE
    NCTC8325        DEILAQLDYVIGAIHQSFNQSEEQIMERLANACRNPYVRHIAHPTGRIIGRRDGYKPNIE
    Newman          DEILAQLDYVIGAIHQSFNQSEEQIMERLANACRNPYVRHIAHPTGRIIGRRDGYKPNIE
    USA300_FPR3757  DEILAQLDYVIGAIHQSFNQSEEQIMERLANACRNPYVRHIAHPTGRIIGRRDGYKPNIE
                    ************************************************************

    COL             QLMALAEETNTVLEINANPHRLDLSADIVRKYPNVKLTINTDAHHTNHLDFMNYGVATAQ
    N315            QLMALAEETNTVLEINANPHRLDLNAEIVRKYPNVKLTINTDAHHTNHLDFMNYGVATAQ
    NCTC8325        QLMALAEETNTVLEINANPHRLDLSADIVRKYPNVKLTINTDAHHTNHLDFMNYGVATAQ
    Newman          QLMALAEETNTVLEINANPHRLDLSADIVRKYPNVKLTINTDAHHTNHLDFMNYGVATAQ
    USA300_FPR3757  QLMALAEETNTVLEINANPHRLDLSADIVRKYPNVKLTINTDAHHTNHLDFMNYGVATAQ
                    ************************.*:*********************************

    COL             KGFVTKDRVINALSREAFKDFIENNTKLKK
    N315            KGFVTKDRVINALSREAFKDFIENNIKLKK
    NCTC8325        KGFVTKDRVINALSREAFKDFIENNTKLKK
    Newman          KGFVTKDRVINALSREAFKDFIENNTKLKK
    USA300_FPR3757  KGFVTKDRVINALSREAFKDFIENNTKLKK
                    ************************* ****