From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003382000
  • symbol?: mutS2
  • description?: recombination and DNA strand exchange inhibitor protein

      descriptions from strain specific annotations:

    • recombination and DNA strand exchange inhibitor protein
    • endonuclease MutS2
    • mutS2 protein
    • DNA mismatch repair protein MutS
    • MutS family DNA mismatch repair protein
    • Recombination inhibitory protein MutS2
  • strand?: +
  • coordinates?: 3743901..3746061
  • synteny block?: BlockID0024650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0991 (mutS2)
    NCTC8325:
    Newman:
    NWMN_1056 (mutS2)
    USA300_FPR3757:
    SAUSA300_1043 (mutS2)
    04-02981:
    SA2981_1100 (mutS2)
    08BA02176:
    C248_1171
    11819-97:
    MS7_1101 (mutS2)
    71193:
    ST398NM01_1140
    ECT-R 2:
    ECTR2_998
    ED133:
    SAOV_1141
    ED98:
    SAAV_1111
    HO 5096 0412:
    SAEMRSA15_09740
    JH1:
    SaurJH1_1225
    JH9:
    SaurJH9_1203
    JKD6008:
    SAA6008_01098
    JKD6159:
    SAA6159_00998
    LGA251:
    SARLGA251_10560
    M013:
    M013TW_1077
    MRSA252:
    SAR1117
    MSHR1132:
    SAMSHR1132_09900
    MSSA476:
    SAS1078
    Mu3:
    SAHV_1135 (mutS2)
    Mu50:
    SAV1144 (mutS2)
    MW2:
    MW1027 (mutS2)
    RF122:
    SAB1008
    ST398:
    SAPIG1140
    T0131:
    SAT0131_01186 (truA)
    TCH60:
    HMPREF0772_12089 (mutS3)
    TW20:
    SATW20_11380
    USA300_TCH1516:
    USA300HOU_1079
    VC40:
    SAVC_04885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNFETVVFQMEETDEIAQIYNKH
    N315            MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNFETVVFQMEETDEIAQIYNKH
    NCTC8325        MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNFETVVFQMEETDEIAQIYNKH
    Newman          MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNFETVVFQMEETDEIAQIYNKH
    USA300_FPR3757  MRQKTLDVLEFEKIKSLVANETISDLGLEKVNQMMPATNFETVVFQMEETDEIAQIYNKH
                    ************************************************************

    COL             RLPSLSGLSKVSAFIHRADIGGVLNVSELNLIKRLIQVQNQFKTFYNQLVEEDEGVKYPI
    N315            RLPSLSGLSKVSAFIHRADIGGVLNVSELNLIKRLIQVQNQFKTFYNQLVEEDEGVKYPI
    NCTC8325        RLPSLSGLSKVSAFIHRADIGGVLNVSELNLIKRLIQVQNQFKTFYNQLVEEDEGVKYPI
    Newman          RLPSLSGLSKVSAFIHRADIGGVLNVSELNLIKRLIQVQNQFKTFYNQLVEEDEGVKYPI
    USA300_FPR3757  RLPSLSGLSKVSAFIHRADIGGVLNVSELNLIKRLIQVQNQFKTFYNQLVEEDEGVKYPI
                    ************************************************************

    COL             LDDKMNQLPVLTDLFQQINETCDTYDLYDNASYELQGIRSKISSTNQRIRQNLDRIVKSQ
    N315            LDDKMNQLPVLTDLFHQINETCDTYDLYDNASYELQGIRSKISSTNQRIRQNLDRIVKSQ
    NCTC8325        LDDKMNQLPVLTDLFQQINETCDTYDLYDNASYELQGIRSKISSTNQRIRQNLDRIVKSQ
    Newman          LDDKMNQLPVLTDLFQQINETCDTYDLYDNASYELQGIRSKISSTNQRIRQNLDRIVKSQ
    USA300_FPR3757  LDDKMNQLPVLTDLFQQINETCDTYDLYDNASYELQGIRSKISSTNQRIRQNLDRIVKSQ
                    ***************:********************************************

    COL             ANQKKLSDAIVTVRNERNVIPVKAEYRQDFNGIVHDQSASGQTLYIEPSSVVEMNNQISR
    N315            ANQKKLSDAIVTVRNERNVIPVKAEYRQDFNGIVHDQSASGQTLYIEPSSVVEMNNQISR
    NCTC8325        ANQKKLSDAIVTVRNERNVIPVKAEYRQDFNGIVHDQSASGQTLYIEPSSVVEMNNQISR
    Newman          ANQKKLSDAIVTVRNERNVIPVKAEYRQDFNGIVHDQSASGQTLYIEPSSVVEMNNQISR
    USA300_FPR3757  ANQKKLSDAIVTVRNERNVIPVKAEYRQDFNGIVHDQSASGQTLYIEPSSVVEMNNQISR
                    ************************************************************

    COL             LRHDEAIEKERILTQLTGYVAADKDALLVAEQVMGQLDFLIAKARYSRSIKGTKPIFKED
    N315            LRHDEAIEKERVLTQLTGYVAADKDALLVAEQVMGQLDFLIAKARYSRSIKGTKPIFKEE
    NCTC8325        LRHDEAIEKERILTQLTGYVAADKDALLVAEQVMGQLDFLIAKARYSRSIKGTKPIFKED
    Newman          LRHDEAIEKERILTQLTGYVAADKDALLVAEQVMGQLDFLIAKARYSRSIKGTKPIFKED
    USA300_FPR3757  LRHDEAIEKERILTQLTGYVAADKDALLVAEQVMGQLDFLIAKARYSRSIKGTKPIFKED
                    ***********:***********************************************:

    COL             RTVYLPKAYHPLLNRETVVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGL
    N315            RTVYLPKAYHPLLNRETVVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGL
    NCTC8325        RTVYLPKAYHPLLNRETVVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGL
    Newman          RTVYLPKAYHPLLNRETVVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGL
    USA300_FPR3757  RTVYLPKAYHPLLNRETVVANTIEFMEDIETVIITGPNTGGKTVTLKTLGLIIVMAQSGL
                    ************************************************************

    COL             LIPTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHADKHSLVLFDELGA
    N315            LIPTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHADKHSLVLFDELGA
    NCTC8325        LIPTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHADKHSLVLFDELGA
    Newman          LIPTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHADKHSLVLFDELGA
    USA300_FPR3757  LIPTLDGSQLSVFKNVYCDIGDEQSIEQSLSTFSSHMTNIVEILKHADKHSLVLFDELGA
                    ************************************************************

    COL             GTDPSEGAALAMSILDHVRKIGSLVMATTHYPELKAYSYNREGVMNASVEFDVDTLSPTY
    N315            GTDPSEGAALAMSILDHVRKIGSLVMATTHYPELKAYSYNREGVMNASVEFDVDTLSPTY
    NCTC8325        GTDPSEGAALAMSILDHVRKIGSLVMATTHYPELKAYSYNREGVMNASVEFDVDTLSPTY
    Newman          GTDPSEGAALAMSILDHVRKIGSLVMATTHYPELKAYSYNREGVMNASVEFDVDTLSPTY
    USA300_FPR3757  GTDPSEGAALAMSILDHVRKIGSLVMATTHYPELKAYSYNREGVMNASVEFDVDTLSPTY
                    ************************************************************

    COL             KLLMGVPGRSNAFDISKKLGLSLNIINKAKTMIGTDEKEINEMIESLERNYKRVETQRLE
    N315            KLLMGVPGRSNAFDISKKLGLSLNIINKAKTMIGTDEKEINEMIESLERNYKRVETQRLE
    NCTC8325        KLLMGVPGRSNAFDISKKLGLSLNIINKAKTMIGTDEKEINEMIESLERNYKRVETQRLE
    Newman          KLLMGVPGRSNAFDISKKLGLSLNIINKAKTMIGTDEKEINEMIESLERNYKRVETQRLE
    USA300_FPR3757  KLLMGVPGRSNAFDISKKLGLSLNIINKAKTMIGTDEKEINEMIESLERNYKRVETQRLE
                    ************************************************************

    COL             LDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKANQKIKAATKEADDIIKDLRQLRE
    N315            LDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKANQKIKAATKEADDIIKDLRQLRE
    NCTC8325        LDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKANQKIKAATKEADDIIKDLRQLRE
    Newman          LDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKANQKIKAATKEADDIIKDLRQLRE
    USA300_FPR3757  LDRLVKEAEQVHDDLSKQYQQFQNYEKSLIEEAKEKANQKIKAATKEADDIIKDLRQLRE
                    ************************************************************

    COL             QKGADVKEHELIDKKKRLDDHYEAKSIKQNVQKQKYDKIVAGDEVKVLSYGQKGEVLEIV
    N315            QKGADVKEHELIDKKKRLDDHYEAKSIKQNVQKQKYDKIVAGDEVKVLSYGQKGEVLEIV
    NCTC8325        QKGADVKEHELIDKKKRLDDHYEAKSIKQNVQKQKYDKIVAGDEVKVLSYGQKGEVLEIV
    Newman          QKGADVKEHELIDKKKRLDDHYEAKSIKQNVQKQKYDKIVAGDEVKVLSYGQKGEVLEIV
    USA300_FPR3757  QKGADVKEHELIDKKKRLDDHYEAKSIKQNVQKQKYDKIVAGDEVKVLSYGQKGEVLEIV
                    ************************************************************

    COL             NDEEAIVQMGIIKMKLPIEDLEKKQKEKVKPTKMVTRQNRQTIKTELDLRGYRYEDALIE
    N315            NDEEAIVQMGIIKMKLPIEDLEKKQKEKVKPTKMVTRQNRQTIKTELDLRGYRYEDALIE
    NCTC8325        NDEEAIVQMGIIKMKLPIEDLEKKQKEKVKPTKMVTRQNRQTIKTELDLRGYRYEDALIE
    Newman          NDEEAIVQMGIIKMKLPIEDLEKKQKEKVKPTKMVTRQNRQTIKTELDLRGYRYEDALIE
    USA300_FPR3757  NDEEAIVQMGIIKMKLPIEDLEKKQKEKVKPTKMVTRQNRQTIKTELDLRGYRYEDALIE
                    ************************************************************

    COL             LDQYLDQAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVAT
    N315            LDQYLDQAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVAT
    NCTC8325        LDQYLDQAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVAT
    Newman          LDQYLDQAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVAT
    USA300_FPR3757  LDQYLDQAVLSNYEQVYIIHGKGTGALQKGVQQHLKKHKSVSDFRGGMPSEGGFGVTVAT
                    ************************************************************

    COL             LK
    N315            LK
    NCTC8325        LK
    Newman          LK
    USA300_FPR3757  LK
                    **