From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003389000
  • symbol?: sdhB
  • description?: succinate dehydrogenase iron-sulfur subunit

      descriptions from strain specific annotations:

    • succinate dehydrogenase iron-sulfur subunit
    • putative succinate dehydrogenase iron-sulfurprotein
    • Succinate dehydrogenase iron-sulfur protein
    • Succinate dehydrogenase subunit B
    • succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  • strand?: +
  • coordinates?: 3751699..3752514
  • synteny block?: BlockID0024720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1160 (sdhB)
    N315:
    SA0996 (sdhB)
    NCTC8325:
    Newman:
    NWMN_1062 (sdhB)
    USA300_FPR3757:
    04-02981:
    SA2981_1105 (sdhB)
    08BA02176:
    C248_1178 (sdhB)
    11819-97:
    MS7_1106
    71193:
    ST398NM01_1145
    ECT-R 2:
    ECTR2_1003
    ED133:
    SAOV_1146
    ED98:
    SAAV_1117 (sdhB)
    HO 5096 0412:
    SAEMRSA15_09790 (sdhB)
    JH1:
    SaurJH1_1230 (sdhB)
    JH9:
    SaurJH9_1208 (sdhB)
    JKD6008:
    SAA6008_01103 (sdhB)
    JKD6159:
    SAA6159_01003 (sdhB)
    LGA251:
    SARLGA251_10610 (sdhB)
    M013:
    M013TW_1082
    MRSA252:
    SAR1122 (sdhB)
    MSHR1132:
    SAMSHR1132_09950
    MSSA476:
    SAS1083 (sdhB)
    Mu3:
    SAHV_1140 (sdhB)
    Mu50:
    SAV1149 (sdhB)
    MW2:
    MW1032 (sdhB)
    RF122:
    SAB1013 (sdhB)
    ST398:
    SAPIG1145
    T0131:
    SAT0131_01192 (rpoA)
    TCH60:
    HMPREF0772_12084 (sdhB)
    TW20:
    SATW20_11430 (sdhB)
    USA300_TCH1516:
    USA300HOU_1085 (sdhB)
    VC40:
    SAVC_04910 (sdhB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
    N315            MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
    NCTC8325        MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
    Newman          MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
    USA300_FPR3757  MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
                    ************************************************************

    COL             RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
    N315            RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
    NCTC8325        RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
    Newman          RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
    USA300_FPR3757  RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
                    ************************************************************

    COL             VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
    N315            VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
    NCTC8325        VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
    Newman          VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
    USA300_FPR3757  VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
                    ************************************************************

    COL             CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
    N315            CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
    NCTC8325        CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
    Newman          CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
    USA300_FPR3757  CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
                    ************************************************************

    COL             GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
    N315            GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
    NCTC8325        GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
    Newman          GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
    USA300_FPR3757  GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
                    *******************************